SecReT6
Protein ID: 387870041
SecReT6 ID600
T6SS typei3
Gene symbol-
Locus tagEPYR_00660
StrainErwinia pyrifoliae DSM 12163
Repliconchromosome [GenBank: NC_017390] [Browse all T6SS(s) in this replicon]
Location [Strand]728978..730798 [+]
Producthypothetical protein
NoteFha
UniProt IDD2T468
KEGG IDepr:EPYR_00660
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 6.10E-08, Aligned region: 27..94
UreE_N [PF02814], Evalue: 0.0028, Aligned region: 30..49
UreE_N [PF02814], Evalue: 0.0028, Aligned region: 78..99
UreE_N [PF02814], Evalue: 0.0028, Aligned region: 186..202
Protein Sequence: 606 a.a.     [Download]
>gi|387870041|ref|YP_005801411.1| hypothetical protein EPYR_00660 [Erwinia pyrifoliae DSM 12163]
MRFTIITSKQGQQPPQGSCDFLPPGGTIGRGADNNLVLPDDDRTISRLQAIVHISATGECHITNRGNVTR
VHLNDIPLERGRQVELQDGDIIGIDDYRLQVSELSAGAQPLSQPVPAPAAPRPQPVAPAAAAAPAAIPSE
IWDSLAQEFSISDNLSSRSKAKPQSQANPLTAPAAAERNPADPLAQLAQNSDPLNLERRDRTPDRLFNQD
PLFKQDSIFDDSTPSTLFQPPGAKSSVTQGARQDEQDPLALFGAGAAPQVDRDDPLGLMMGSAVPLTPPE
DKPQQTSEQPIIPLTPEPVPPVTGEKTSSSADELPDSDFSLFGDDKTQQSDEANSPLFDVPPPGPAAAQP
TASSASGDYGGITLPTPQARARSSTPPPKGRLSIDPVANSTAHSSGSSGEVLDGDLMAALVGGMGLQDLQ
PTPRFDQHAMQELGQMLSMFSQGTVALLSSRSILKRGVKAEMTVILDEANNPFKLLPSGKSVLMQMFGSR
MPGFMPPKQSVRDALVDLQAHQLGMIAGIRALIASMLQSFNPQQLEEEARQEGAISRLSLPGSRKAALWD
HFSKRYSETAGEIEDDFHTLFGEAFLHAYDMEVNQYKDSQIRSEER
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|387869382|ref|NC_017390.1|:728978-730798 Erwinia pyrifoliae DSM 12163, complete genome
ATGCGATTTACAATTATAACGAGCAAACAGGGCCAGCAGCCGCCGCAGGGCAGCTGCGACTTTCTGCCGC
CCGGCGGCACCATTGGTCGTGGTGCTGATAACAACCTGGTGCTGCCGGATGATGACCGCACCATTTCACG
CCTGCAGGCTATCGTGCATATCAGCGCCACGGGCGAGTGCCATATCACCAATCGTGGCAACGTGACGCGC
GTCCACCTGAATGATATTCCGCTGGAGCGTGGCCGCCAGGTCGAGCTGCAGGATGGCGATATTATCGGCA
TTGACGACTATCGCCTGCAGGTCAGCGAACTGAGCGCAGGCGCGCAGCCGCTAAGCCAGCCGGTGCCAGC
GCCCGCAGCGCCGCGCCCGCAGCCGGTCGCCCCGGCGGCAGCCGCTGCGCCAGCTGCTATCCCCAGCGAG
ATCTGGGACAGCCTGGCGCAGGAGTTCTCGATCTCCGATAACCTCTCCAGCCGCAGCAAAGCCAAACCGC
AAAGCCAGGCTAACCCGCTGACCGCCCCGGCCGCCGCCGAGCGTAATCCGGCCGATCCGCTGGCGCAGCT
GGCGCAGAACAGCGATCCGCTAAACCTCGAACGCCGCGATCGCACCCCCGACCGCCTGTTTAACCAGGAT
CCGCTGTTTAAACAGGACAGCATCTTTGATGACAGCACCCCCAGTACGCTGTTCCAGCCGCCGGGGGCAA
AAAGCAGCGTTACGCAGGGCGCACGTCAGGATGAGCAGGACCCGCTGGCGCTGTTCGGCGCAGGCGCAGC
GCCACAGGTCGATCGCGACGACCCGCTCGGCCTGATGATGGGCAGCGCCGTGCCGCTGACGCCGCCAGAG
GATAAGCCGCAGCAGACCTCAGAGCAGCCGATCATTCCGCTAACGCCAGAACCCGTGCCGCCTGTCACCG
GGGAAAAAACATCATCTTCGGCGGATGAGCTGCCGGACAGCGATTTCAGCCTGTTTGGCGACGACAAAAC
GCAGCAGTCAGACGAGGCCAACTCGCCGCTGTTTGACGTGCCGCCGCCTGGCCCGGCCGCCGCTCAGCCT
ACGGCGTCCTCCGCCAGCGGTGACTACGGCGGTATTACGCTGCCGACCCCTCAGGCGCGCGCGCGTAGCA
GCACTCCACCACCGAAAGGTCGGCTGAGTATCGACCCGGTGGCCAACAGCACGGCGCACAGCAGCGGCAG
CAGCGGTGAAGTGCTGGACGGCGATCTGATGGCGGCGCTGGTCGGCGGTATGGGCCTGCAGGATCTGCAA
CCCACACCGCGCTTTGACCAGCACGCGATGCAGGAGCTGGGGCAGATGCTCAGCATGTTCTCGCAGGGCA
CGGTGGCGCTGCTCTCTTCGCGTTCGATCCTTAAGCGCGGCGTAAAAGCCGAAATGACGGTGATCCTCGA
CGAGGCCAATAACCCGTTTAAGCTGCTGCCGTCCGGCAAATCGGTACTGATGCAGATGTTTGGCAGCCGC
ATGCCGGGCTTTATGCCGCCAAAACAGTCGGTGCGCGATGCGCTGGTCGATTTGCAGGCGCACCAGCTGG
GGATGATCGCCGGCATCCGTGCGCTGATTGCCTCGATGCTGCAATCATTTAATCCCCAGCAGCTGGAGGA
GGAAGCGCGCCAGGAAGGTGCCATCTCGCGCCTGTCGCTGCCGGGCAGCCGCAAAGCCGCGCTGTGGGAC
CACTTCAGCAAACGCTATAGCGAAACCGCCGGCGAGATTGAAGACGACTTCCATACCCTGTTTGGTGAAG
CCTTCCTCCATGCTTACGATATGGAAGTCAACCAGTACAAAGACTCACAGATCAGATCGGAAGAAAGATG
A