SecReT6
Protein ID: 387870044
SecReT6 ID600
T6SS typei3
Gene symbol-
Locus tagEPYR_00663
StrainErwinia pyrifoliae DSM 12163
Repliconchromosome [GenBank: NC_017390] [Browse all T6SS(s) in this replicon]
Location [Strand]732585..733406 [+]
Producttype VI secretion system-associated hypothetical protein
NoteTagJ
UniProt IDD2T471
KEGG IDepr:EPYR_00663
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 8.30E-40, Aligned region: 143..266
Protein Sequence: 273 a.a.     [Download]
>gi|387870044|ref|YP_005801414.1| type VI secretion system-associated hypothetical protein [Erwinia pyrifoliae DSM 12163]
MHSLQHLMDGQSLAETLARIESQIKRQPADADLRASFVQLLCLAGNWSRAQTQLKSWLALKPQAQPTVQL
LDQTINAERQRAAVFAGEASPRMPGAAWNWAEQLLAALAADAAGDRAQAQRLRGCALEAAQLNPGQLTHQ
NQQQTFDWLTDGDGRLGPVCELIANGQYSWLPFSAISEIRFQAPVSVTDLVWRHTLVRLVDGSEQVCQIP
VRYPFVEQADDRYRLATLTEWQPLPGDDQQFSGHGQKCWFSADAEFPLLGMEMLAFSDAEPAL
 
Nucleotide Sequence: 822 bp     [Download]
>gi|387869382|ref|NC_017390.1|:732585-733406 Erwinia pyrifoliae DSM 12163, complete genome
ATGCATTCGTTACAACATCTGATGGACGGCCAGTCGCTGGCTGAAACTCTGGCAAGAATCGAAAGCCAGA
TAAAACGCCAGCCTGCCGATGCCGATCTGCGCGCCAGCTTTGTCCAGCTGCTGTGCCTGGCGGGCAACTG
GAGCCGGGCGCAGACGCAGCTAAAATCCTGGCTGGCGCTGAAACCACAGGCGCAGCCCACGGTCCAGCTG
CTGGACCAGACGATTAACGCTGAACGCCAGCGTGCGGCGGTATTTGCCGGTGAAGCATCACCGCGTATGC
CGGGCGCGGCATGGAATTGGGCAGAGCAGCTGCTGGCCGCGCTGGCGGCCGATGCCGCTGGCGATCGTGC
TCAGGCGCAACGGCTGCGCGGCTGCGCTTTAGAAGCGGCGCAGCTGAATCCCGGGCAGTTGACGCACCAG
AACCAGCAGCAAACCTTTGACTGGCTTACAGACGGTGACGGGCGGCTCGGCCCGGTGTGCGAACTGATTG
CCAACGGACAGTACAGCTGGCTGCCGTTCAGCGCCATCAGCGAAATACGCTTTCAGGCTCCGGTCAGCGT
CACCGACCTGGTATGGCGGCATACGCTGGTCAGACTGGTGGATGGCAGCGAGCAGGTGTGCCAGATACCG
GTACGCTATCCGTTTGTCGAACAGGCCGACGACCGCTACCGGCTGGCCACGCTGACCGAATGGCAACCGC
TGCCGGGCGATGACCAGCAGTTCAGCGGCCACGGGCAGAAATGCTGGTTCAGCGCCGACGCCGAATTCCC
GCTGCTGGGCATGGAGATGCTGGCGTTTAGCGATGCAGAGCCAGCCTTATGA