SecReT6
Protein ID: 387870045
SecReT6 ID600
T6SS typei3
Gene symbol-
Locus tagEPYR_00664
StrainErwinia pyrifoliae DSM 12163
Repliconchromosome [GenBank: NC_017390] [Browse all T6SS(s) in this replicon]
Location [Strand]733403..733969 [+]
Producthypothetical protein
NoteTssE
UniProt IDD2T472
KEGG IDepr:EPYR_00664
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.60E-19, Aligned region: 57..167
Protein Sequence: 188 a.a.     [Download]
>gi|387870045|ref|YP_005801415.1| hypothetical protein EPYR_00664 [Erwinia pyrifoliae DSM 12163]
MSQHSDEGHKLLHGGYRQRRQQEGLNIRDKMQPSLLDRLTDNAPDNPREAAHSTLISHSALRRNVLRDLQ
WLFNTINNEAQQDLSPFPHVQRSTLNFGISPLAGQRMSDIEWQDIQRKLSAAILNFEPRILPAGLQVRCV
SDTSSLDLHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENGHFALRDMG
 
Nucleotide Sequence: 567 bp     [Download]
>gi|387869382|ref|NC_017390.1|:733403-733969 Erwinia pyrifoliae DSM 12163, complete genome
ATGAGCCAGCACAGCGATGAAGGGCATAAGCTGCTGCACGGCGGTTACCGCCAGCGCCGCCAGCAGGAAG
GGCTGAACATCCGCGACAAAATGCAGCCATCGCTGCTCGATCGTCTGACCGACAACGCGCCGGATAATCC
GCGTGAAGCGGCGCACAGCACGCTGATCTCGCACAGCGCGCTGCGGCGCAACGTGCTGCGCGACCTGCAG
TGGCTGTTTAATACCATTAACAATGAAGCGCAGCAGGATCTGTCACCATTCCCGCATGTACAGCGTTCGA
CGCTGAACTTTGGCATTTCGCCGCTGGCGGGGCAGCGCATGTCGGATATTGAATGGCAGGATATCCAGCG
CAAGCTAAGCGCGGCGATCCTCAACTTCGAACCGCGCATTCTGCCCGCCGGGTTACAGGTGCGCTGCGTG
TCCGACACCAGCTCGCTTGACCTGCACAACGTGTTGTCGATTGAGATCAAGGGCCGCCTGTGGTGCGTGC
CGTATCCGCTGGAATTTCTGTTTCGTACCGATGTGGATCTGGAAAACGGCCATTTTGCCCTGCGTGATAT
GGGTTAA