SecReT6
Protein ID: 387870046
SecReT6 ID600
T6SS typei3
Gene symbol-
Locus tagEPYR_00665
StrainErwinia pyrifoliae DSM 12163
Repliconchromosome [GenBank: NC_017390] [Browse all T6SS(s) in this replicon]
Location [Strand]733988..735862 [+]
Producthypothetical protein
NoteTssF
UniProt IDD2T473
KEGG IDepr:EPYR_00665
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.00E-209, Aligned region: 6..624
Protein Sequence: 624 a.a.     [Download]
>gi|387870046|ref|YP_005801416.1| hypothetical protein EPYR_00665 [Erwinia pyrifoliae DSM 12163]
MDSKQLDYYNRELAYLREMGAEFAGRYPKVAGRLGMRGDEVADPYVERLMEGFAFLTSRVQLKMDAEFPR
FSQRLLEMIAPNYLSPTPSMAIAELQPDSRKGDISNGFLVPRGTMMDSQALKQNGVTCSYTTAHDVMLQP
VRIKSVELGGIPANVPLGELGLSQRGAVSALRIRIACDESITLAHLSFDSLMFFLSGPDMQALQLLELVM
QHYVGGYCQSVGSSPQRTLLGDDALQQEGFAADQALLPNDLRNFDGYRLLQEYFAFPARFQFISISQLRP
LLQACDPQAREFDIVLLLDSANPGLERVIDHSHLALHCTPVINLFPKVAQRQKLSDSVHEYHLVVDNIRP
LDYEIFSVQKLYASGERQREEQQFRPFWSTFSDDGGNYGAYFSLRREQRTLSEHAQRFGTRTGYVGSEVF
LSLVDEHNSPWHEDLRYLTAEVMCTSRDLPLLLLQQQGQFVMPDSIPVRQLTLRKGPTPPRPALAEGKMA
WRLVSHLQMNYLSLMDGDDGQGAAALRQMLGLYANLAEAAAARQIDGIRHCQLKPVFRRVPEPGPIVFAR
GIGIELEVDEQAFSGSSPWLLGSVLERVFSRLVAINTFTEMTLTSQQRGEVGYWAPRMGKRTLI
 
Nucleotide Sequence: 1875 bp     [Download]
>gi|387869382|ref|NC_017390.1|:733988-735862 Erwinia pyrifoliae DSM 12163, complete genome
ATGGACAGTAAGCAGCTCGACTATTACAACCGTGAACTGGCGTATCTGCGCGAAATGGGCGCGGAGTTTG
CCGGGCGCTATCCAAAGGTGGCAGGCCGTCTTGGCATGCGCGGCGATGAGGTGGCCGACCCCTACGTTGA
GCGGCTGATGGAGGGCTTTGCCTTTCTCACCTCACGCGTGCAGCTGAAAATGGACGCCGAGTTTCCGCGC
TTCTCCCAGCGCCTGCTGGAGATGATTGCGCCGAACTACCTGTCGCCAACGCCGTCGATGGCGATAGCCG
AACTGCAGCCGGACAGCCGCAAAGGCGATATCAGCAACGGTTTTCTGGTGCCGCGCGGCACCATGATGGA
CAGCCAGGCGCTAAAGCAAAACGGCGTCACCTGCAGTTACACCACCGCCCATGACGTGATGCTGCAACCG
GTGCGCATCAAAAGCGTTGAGCTGGGCGGCATTCCGGCCAACGTCCCGCTCGGCGAACTGGGGTTAAGCC
AGCGCGGCGCGGTCAGCGCCCTGCGCATCCGCATCGCCTGTGACGAGAGCATCACGCTTGCACATCTTAG
CTTCGACAGCCTGATGTTCTTCCTCAGCGGGCCGGATATGCAGGCGCTGCAGCTGCTGGAGCTGGTGATG
CAGCACTACGTGGGCGGCTACTGCCAGAGCGTGGGCAGCAGCCCGCAGCGCACGCTACTGGGCGATGATG
CGCTCCAGCAGGAAGGGTTTGCCGCAGACCAGGCGCTGCTGCCAAACGATCTGCGTAATTTCGATGGCTA
TCGCCTGTTGCAGGAGTACTTCGCCTTCCCGGCCCGCTTCCAGTTTATCAGCATCAGCCAGCTGCGCCCG
CTGTTACAAGCCTGTGACCCACAGGCGCGTGAATTCGATATCGTGCTGCTGCTGGACAGCGCCAACCCGG
GGCTGGAGCGGGTGATTGACCACAGCCATCTGGCGCTGCACTGCACCCCGGTAATCAACCTGTTTCCGAA
AGTGGCGCAGCGGCAAAAGCTCAGCGACAGCGTGCACGAATATCATCTGGTGGTGGATAACATCCGCCCG
CTGGACTACGAGATTTTCTCGGTGCAGAAGCTATACGCCAGTGGCGAGCGCCAGCGCGAGGAGCAGCAGT
TCCGCCCGTTCTGGAGCACCTTCAGCGATGACGGCGGTAACTACGGGGCTTACTTCTCGCTGCGGCGCGA
ACAGCGCACCCTGTCCGAACATGCGCAGCGCTTCGGCACGCGCACCGGCTACGTCGGGTCGGAAGTGTTT
CTGTCGCTGGTCGACGAGCACAATTCGCCCTGGCATGAGGATCTGCGCTATCTGACTGCCGAGGTGATGT
GTACCAGCCGCGATCTGCCGCTACTGCTGCTGCAACAGCAGGGGCAGTTTGTGATGCCTGATTCGATCCC
GGTGCGCCAGCTTACGCTGCGTAAAGGGCCGACGCCGCCACGTCCGGCGCTGGCCGAGGGAAAAATGGCC
TGGCGGCTGGTCAGCCATTTGCAGATGAACTATCTCAGCCTGATGGACGGTGATGACGGGCAGGGGGCGG
CGGCGTTACGCCAGATGCTCGGGCTTTACGCTAATCTCGCCGAAGCCGCTGCGGCGCGCCAGATCGACGG
TATTCGCCACTGCCAGCTGAAGCCGGTGTTCCGGCGCGTGCCGGAGCCTGGCCCGATTGTCTTTGCCCGT
GGCATCGGCATTGAGCTGGAGGTGGACGAGCAGGCGTTTTCCGGCAGCAGCCCGTGGCTACTCGGCAGCG
TGCTGGAGCGGGTGTTCTCGCGGCTGGTGGCGATCAACACCTTTACCGAAATGACGCTGACCAGCCAGCA
GCGCGGCGAGGTCGGCTACTGGGCGCCGCGCATGGGCAAAAGGACACTGATATGA