SecReT6
Protein ID: 387870047
SecReT6 ID600
T6SS typei3
Gene symbol-
Locus tagEPYR_00666
StrainErwinia pyrifoliae DSM 12163
Repliconchromosome [GenBank: NC_017390] [Browse all T6SS(s) in this replicon]
Location [Strand]735859..736917 [+]
Producthypothetical protein
NoteTssG
UniProt IDD2T474
KEGG IDepr:EPYR_00666
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.00E-106, Aligned region: 28..332
Protein Sequence: 352 a.a.     [Download]
>gi|387870047|ref|YP_005801417.1| hypothetical protein EPYR_00666 [Erwinia pyrifoliae DSM 12163]
MTQQPAAQAEKIHRLHRLPPDFWAALCATPWRYDLFQLLRRLDAQGGHRYPLGRAPLPRHEPLRIGQRPS
LAFAPAAIAGVTPRENSALHDVSIYSFGLFGPNGPLPVHLTEYARERSDHHQDNSLSAFADLFHHRLTLL
FYRAWADAQPTVALDRAEKRQFERWLASLIGMGQPGQLKQGSLSAHSRLALAGHLTRHARDAEGLQKVLS
HYFQVPVRLVENVPHWQPVDRRDRASLGAGRRKPRLGVSAFLGVAVRDVQHKLRLDLGPLPMASYQRFLP
GEPWAVQLRDWVRQYLGIEFLWEVRLILDAADVQGVTLGGASRLGYSSWLGQPAIPQHRSDLTFSPEPQE
SV
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|387869382|ref|NC_017390.1|:735859-736917 Erwinia pyrifoliae DSM 12163, complete genome
ATGACACAGCAGCCCGCCGCGCAGGCAGAGAAAATTCACCGCCTGCATCGCCTGCCGCCGGACTTCTGGG
CGGCGCTGTGCGCCACGCCGTGGCGCTATGACCTGTTCCAGCTGCTGCGGCGGCTGGATGCGCAGGGCGG
TCACCGCTATCCGCTGGGGCGTGCGCCGCTGCCGCGCCACGAACCGCTGCGCATCGGCCAGCGGCCGTCG
CTGGCCTTTGCCCCGGCGGCCATCGCCGGCGTCACGCCGCGTGAAAACAGTGCGCTGCACGATGTCTCGA
TCTACAGCTTCGGCCTGTTTGGCCCCAACGGCCCGCTGCCTGTCCATCTGACGGAATATGCGCGTGAGCG
CAGCGACCACCACCAGGACAACAGCCTGAGCGCCTTTGCCGATCTGTTCCACCATCGCCTGACGCTGCTG
TTTTACCGCGCCTGGGCAGATGCGCAGCCCACGGTGGCGCTGGACCGGGCGGAAAAACGCCAGTTTGAGC
GCTGGCTCGCCAGCCTGATCGGCATGGGGCAGCCGGGGCAGCTAAAACAGGGCAGCCTCAGTGCGCATTC
ACGGCTGGCGCTGGCCGGGCATCTGACCCGCCACGCCCGCGATGCCGAGGGACTGCAAAAAGTCCTCAGT
CACTACTTTCAGGTGCCGGTGCGGCTGGTGGAAAACGTGCCTCACTGGCAGCCGGTTGACCGTCGCGACC
GCGCCAGCCTGGGGGCCGGACGGCGCAAACCGCGACTCGGGGTTTCTGCGTTTCTCGGCGTGGCGGTGCG
CGATGTGCAGCACAAGTTACGTCTGGATCTGGGACCGCTGCCAATGGCCAGCTACCAGCGTTTTCTGCCC
GGCGAACCCTGGGCGGTGCAGCTGCGCGACTGGGTGCGTCAGTATCTGGGCATTGAATTTCTCTGGGAGG
TGCGGCTGATCCTTGACGCCGCCGATGTGCAGGGCGTCACCCTCGGCGGCGCATCCCGGCTGGGATACAG
CAGCTGGCTGGGACAGCCGGCTATCCCACAGCACCGCAGCGATCTCACCTTTAGTCCGGAGCCGCAGGAA
AGTGTTTAA