SecReT6
Protein ID: 387870052
SecReT6 ID600
T6SS typei3
Gene symbolvgrG
Locus tagEPYR_00671
StrainErwinia pyrifoliae DSM 12163
Repliconchromosome [GenBank: NC_017390] [Browse all T6SS(s) in this replicon]
Location [Strand]742246..744207 [+]
Producttype VI secretion system, effector protein vgrG
NoteTssI
UniProt IDD2T479
KEGG IDepr:EPYR_00671
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.10E-70, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 1.90E-25, Aligned region: 365..458
Protein Sequence: 653 a.a.     [Download]
>gi|387870052|ref|YP_005801422.1| type VI secretion system, effector protein vgrG [Erwinia pyrifoliae DSM 12163]
MFDRITVQLPMDGLLFWRMSGREALSQSFELSVQLLSTDARIERRALLGQPIVISIPTQGIMSTRYLNGK
ITKVSVSSQELSGTRYAVXTLVMEPDLWPLKRDKNLRIFQGQTVPQIVKTLLGEYNVALEDRLTGSYRSW
EYCVQYQESSFNFISRLMELEGIYYYFRHEADGHRLVLMDAEQQHQPFSGYEAIPYHATPSGGITSAEGI
SGWEFADAVTPGIYSIDDYDFRKPNAWMLQARQNPASPQPGAIDVYDWPGHFVDHDHGEFYVKIRQQVWQ
VEHQQISATGTALGLAPGYTFAVLNAPFISDNGEYLTTEACYDFEENSYASGGDSSSRHNISVQVIPSDI
TFRAQPDTPWPRTHGPQTAKVVGPKGESIWTDKYGRIKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYGG
VQIPRVGDEVVVDFINGDPDRPIVTGRVYNEASMPPWALPAAATQMGFMSRSKDGTPDNANALRFEDKAG
HEQIWLHAEKNMDTEVEHCETHDVGVDRHKTVGRDEKNIVKRNMLTDVGMHATSHTAEKHIINVGEDQAV
LTMDKQGNVLLEATASIRLKVKNNYILITPSAIEIQVAEGDLMAESEKGALLKGNELTLLGGGTDAELSA
SDTVSITGTNATDIKGALVKVNS
 
Nucleotide Sequence: 1962 bp     [Download]
>gi|387869382|ref|NC_017390.1|:742246-744207 Erwinia pyrifoliae DSM 12163, complete genome
ATGTTTGACCGTATCACCGTACAGCTGCCGATGGACGGCCTGCTGTTCTGGCGCATGAGCGGGCGCGAAG
CGCTGTCGCAGTCATTTGAACTGAGCGTGCAGCTGTTAAGCACCGATGCGCGCATCGAGCGCAGGGCGCT
GCTCGGCCAGCCGATCGTCATCTCCATCCCCACCCAGGGGATAATGAGTACCCGCTACCTGAACGGCAAA
ATCACCAAAGTGTCGGTCAGCAGCCAGGAGCTGAGCGGCACGCGCTACGCGGTGTANACCCTGGTGATGG
AGCCGGACCTGTGGCCGCTGAAGCGCGACAAAAATCTGCGCATTTTCCAGGGGCAGACGGTGCCGCAGAT
CGTCAAAACCCTGCTGGGTGAGTACAACGTGGCGCTGGAAGACCGGCTGACCGGCAGCTACCGCAGCTGG
GAGTACTGCGTGCAGTACCAGGAGAGCAGCTTTAACTTTATCAGCCGNCTGATGGAGCTGGAGGGGATCT
ACTACTACTTCCGCCACGAGGCGGACGGGCACAGGCTGGTGCTGATGGACGCGGAGCAGCAGCACCAGCC
GTTCAGCGGCTACGAGGCGATCCCTTACCACGCCACGCCATCCGGTGGCATTACCAGCGCAGAAGGTATC
AGCGGCTGGGAGTTTGCCGATGCGGTCACACCGGGTATCTACAGCATCGACGACTACGACTTCCGCAAAC
CGAACGCATGGATGCTGCAGGCGCGGCAGAATCCGGCCTCGCCGCAGCCGGGGGCGATAGACGTCTACGA
CTGGCCTGGCCACTTTGTTGACCACGATCACGGTGAGTTCTACGTGAAAATCCGCCAGCAAGTGTGGCAG
GTGGAGCATCAGCAGATTAGCGCCACAGGCACCGCACTCGGCCTGGCACCGGGTTACACCTTTGCGGTGT
TGAATGCGCCCTTTATCAGTGATAACGGTGAATATCTGACCACCGAAGCCTGCTATGACTTTGAGGAAAA
CAGCTACGCCAGCGGCGGCGATAGCAGCAGCAGGCACAATATCTCTGTTCAGGTGATCCCTTCGGATATC
ACCTTCCGCGCACAGCCGGACACGCCGTGGCCGCGCACCCACGGGCCGCAGACGGCGAAGGTGGTGGGGC
CGAAGGGCGAGTCGATCTGGACCGATAAATATGGCCGCATCAAAGTGAAATTTCACTGGGACAGGCTGGC
GAAGGGCGACGATACCAGCTCGTGCTGGGTGCGCGTCTCCAGCGCCTGGGCGGGCCAGGGCTACGGTGGG
GTGCAGATCCCGCGCGTGGGCGACGAGGTGGTGGTCGACTTTATCAACGGCGACCCGGACCGACCGATCG
TCACCGGGCGCGTGTACAACGAGGCGAGCATGCCGCCGTGGGCGCTGCCCGCCGCCGCCACGCAGATGGG
CTTTATGAGCCGTTCGAAGGACGGTACGCCGGACAACGCCAACGCGCTGCGCTTTGAGGATAAAGCGGGT
CATGAACAAATCTGGCTGCATGCGGAAAAAAATATGGATACCGAGGTTGAACATTGCGAAACCCATGATG
TCGGCGTCGATCGTCATAAAACCGTTGGCCGCGACGAGAAAAACATCGTTAAACGCAACATGCTGACTGA
CGTTGGTATGCATGCAACCAGCCATACCGCAGAGAAACATATCATCAACGTCGGTGAGGATCAGGCCGTT
CTGACCATGGATAAGCAGGGTAATGTGCTGCTTGAAGCCACTGCCAGCATCAGGCTGAAGGTGAAAAATA
ATTACATTCTGATCACCCCATCAGCGATCGAAATACAGGTGGCGGAAGGGGATCTGATGGCGGAAAGCGA
GAAAGGGGCCTTATTGAAAGGCAACGAGCTTACCCTGCTGGGCGGAGGAACCGATGCGGAACTGAGCGCC
AGTGACACCGTCAGTATTACCGGAACCAACGCCACCGATATCAAAGGCGCGCTGGTCAAAGTAAACAGCT
AA