SecReT6
Protein ID: 387870055
SecReT6 ID600
T6SS typei3
Gene symbolvgrG
Locus tagEPYR_00674
StrainErwinia pyrifoliae DSM 12163
Repliconchromosome [GenBank: NC_017390] [Browse all T6SS(s) in this replicon]
Location [Strand]747121..749049 [+]
Producttype VI secretion system, effector protein vgrG
NoteTssI
UniProt IDD2T482
KEGG IDepr:EPYR_00674
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.40E-72, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 1.60E-25, Aligned region: 366..459
Gp5_C [PF06715], Evalue: 0.0094, Aligned region: 502..521
Protein Sequence: 642 a.a.     [Download]
>gi|387870055|ref|YP_005801425.1| type VI secretion system, effector protein vgrG [Erwinia pyrifoliae DSM 12163]
MFDRITVQLPMDGLLFWRMSGREALSQSFELSVQLLSTDARIERRALLGQPITVCIPTQGIMSTRYLNGK
ITKVSVRSQELSGTRYAVXTLVMEPDLWPLKRDKNLRIFQGQTVPQIVKTLLGEYNVALEDRLTGSYRSW
EYCVQYQESSFNFISRLMELEGIYYYFRHEADGHRLVLMDAAQQHQPFSGYEAIPYHVTPSGGSTSEEGI
GLWSLEDSVTPGMYSIDDYDFRKPNAWMLQARQNPASPQPGAIDVYDWPGHFVDHDHGEFYARIRQEVWQ
AEHQQISAAGTALGLAPGNTFTVLNTPFISDNGEYLTTEAYYDFEENQYASGDGGGGTKHNIAIRVIPSG
VTFRATPGTPWPRTHGPQTAKVVGPKGESIWTDKYGRIKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYG
GVQIPRVGDEVVVDFINGDPDRPIVTGRVYNEASMPPWALPAAATQMGFMSRSKDGTPDNANALRFEDKA
GEEQVWIQAERNMDTQVKNDASHSVGKNHSHYVGESELHRVETDRVHGIKGGEQLLTGKGKSDAAAEAYV
IGSGTTLRLECGESVIELTASGQINIVGKGFNFCVEQDGFINTGGKLNINDGTGAATAAPGSSHKANITR
AVEALFPTKKGE
 
Nucleotide Sequence: 1929 bp     [Download]
>gi|387869382|ref|NC_017390.1|:747121-749049 Erwinia pyrifoliae DSM 12163, complete genome
ATGTTTGACCGTATCACCGTACAGCTGCCGATGGACGGCCTGCTGTTCTGGCGCATGAGCGGGCGCGAAG
CGCTGTCGCAGTCATTTGAACTGAGCGTGCAGCTGTTAAGCACCGACGCGCGCATTGAGCGCAGGGCGCT
GCTCGGCCAGCCGATCACCGTTTGCATCCCCACCCAGGGCATAATGAGCACGCGCTATCTGAACGGCAAA
ATCACCAAAGTTTCGGTCCGCAGCCAGGAGCTGAGCGGCACGCGCTACGCGGTGTANACCCTGGTGATGG
AGCCGGACCTGTGGCCGCTGAAGCGCGACAAAAATCTGCGCATTTTCCAGGGGCAGACGGTGCCGCAGAT
CGTCAAAACCCTGCTGGGTGAGTACAACGTGGCGCTGGAAGACCGGCTGACCGGCAGCTACCGCAGCTGG
GAGTACTGCGTGCAGTACCAGGAGAGCAGCTTTAACTTTATCAGCCGNCTGATGGAGCTGGAGGGGATCT
ACTACTACTTCCGCCACGAGGCGGACGGGCACAGGCTGGTGCTGATGGACGCGGCGCAGCAGCATCAGCC
GTTCAGCGGCTACGAGGCGATCCCTTACCACGTCACGCCGTCCGGCGGCAGCACCAGTGAAGAGGGCATC
GGGCTGTGGTCACTGGAGGACAGCGTGACGCCGGGGATGTACAGCATCGACGACTACGACTTCCGCAAAC
CGAACGCATGGATGCTGCAGGCGCGGCAGAATCCGGCGTCGCCGCAGCCGGGTGCCATCGACGTTTACGA
CTGGCCGGGGCATTTTGTTGACCACGACCACGGCGAATTCTATGCGCGCATTCGTCAGGAGGTGTGGCAG
GCGGAGCACCAGCAGATTAGCGCCGCCGGCACCGCGCTGGGGCTGGCGCCGGGCAACACCTTTACGGTGC
TGAACACGCCGTTTATCAGCGATAACGGCGAGTACCTGACCACGGAGGCGTACTACGATTTTGAAGAGAA
CCAGTATGCCAGCGGTGACGGTGGTGGCGGAACAAAACACAATATCGCCATCCGCGTAATCCCCTCCGGC
GTGACTTTCCGCGCCACGCCGGGAACGCCGTGGCCGCGCACCCACGGGCCGCAGACGGCGAAGGTGGTGG
GGCCGAAGGGCGAGTCGATCTGGACCGATAAATATGGCCGCATCAAAGTGAAATTTCACTGGGACAGGCT
GGCAAAAGGCGACGATACTAGCTCGTGCTGGGTGCGCGTCTCCAGCGCCTGGGCGGGCCAGGGCTATGGC
GGGGTGCAGATCCCGCGCGTGGGCGACGAGGTGGTTGTCGACTTTATCAACGGCGATCCGGATCGGCCAA
TCGTCACCGGTCGCGTGTACAACGAGGCGAGCATGCCGCCGTGGGCGCTGCCCGCCGCCGCCACGCAGAT
GGGCTTTATGAGCCGCTCAAAAGACGGCACGCCGGACAACGCCAACGCGCTGCGCTTTGAGGATAAGGCG
GGCGAGGAGCAGGTGTGGATCCAGGCCGAGCGCAATATGGATACCCAGGTGAAGAATGATGCCAGCCACA
GCGTGGGTAAAAATCACAGTCATTACGTTGGAGAAAGTGAGCTGCACCGGGTAGAGACCGATCGCGTGCA
CGGCATTAAGGGCGGCGAACAGCTGCTGACCGGCAAAGGGAAAAGCGATGCGGCGGCAGAAGCCTATGTA
ATAGGTTCCGGCACCACGCTGCGCCTGGAGTGTGGTGAAAGCGTCATTGAACTGACCGCCAGCGGGCAGA
TCAATATTGTCGGCAAGGGCTTTAATTTCTGTGTAGAACAGGACGGCTTTATCAATACCGGCGGTAAGCT
GAATATTAATGATGGTACGGGGGCAGCCACCGCCGCACCGGGTTCATCCCATAAAGCCAATATTACCCGT
GCCGTGGAAGCGCTGTTCCCGACAAAAAAAGGGGAGTAA