SecReT6
Protein ID: 387880773
SecReT6 ID653
T6SS typei1
Gene symbol-
Locus tagCDCO157_0214
StrainEscherichia coli Xuzhou21
Repliconchromosome [GenBank: NC_017906] [Browse all T6SS(s) in this replicon]
Location [Strand]243533..244012 [-]
ProductHcp-like protein
NoteTssD
UniProt IDI1ZQE1
KEGG IDelx:CDCO157_0214
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.70E-31, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|387880773|ref|YP_006311075.1| Hcp-like protein [Escherichia coli Xuzhou21]
MANLIYLTLNGDNQGLISSGCSSQPSIGNKAQTAHIDQIMIYEFMHGLNRDQNVNHHHLTIKKPIDKASP
LLGKAICDNELLTCDFSFYRTNKFGINELFYKIKLTGAKISDIHVSISHIVVDNSVQPEESVSFSYESII
WEHCSAGTSAYSLWEDRLF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|387880559|ref|NC_017906.1|:c244012-243533 Escherichia coli Xuzhou21 chromosome, complete genome
ATGGCGAATTTAATTTATTTAACACTAAATGGTGATAATCAAGGGCTCATTTCAAGTGGTTGTTCATCAC
AACCATCCATTGGAAATAAAGCTCAAACAGCACACATTGATCAAATTATGATTTATGAATTCATGCATGG
ATTAAATCGAGATCAAAACGTCAACCATCATCATTTGACAATAAAAAAACCTATAGATAAAGCATCACCC
TTATTAGGCAAAGCAATTTGCGACAATGAATTATTGACATGTGATTTTTCCTTTTATCGTACAAATAAAT
TTGGAATTAATGAACTGTTCTATAAAATCAAATTAACTGGAGCAAAGATAAGCGACATTCATGTCTCTAT
ATCACATATTGTTGTTGATAACAGCGTTCAACCCGAAGAGTCAGTTTCTTTCAGTTATGAGTCAATTATA
TGGGAGCATTGTTCCGCTGGCACTAGTGCATACAGTTTATGGGAAGATCGTCTTTTTTAA