SecReT6
Protein ID: 387880774
SecReT6 ID653
T6SS typei1
Gene symbol-
Locus tagCDCO157_0215
StrainEscherichia coli Xuzhou21
Repliconchromosome [GenBank: NC_017906] [Browse all T6SS(s) in this replicon]
Location [Strand]243978..245387 [-]
Producthypothetical protein
NoteTssA
UniProt IDI1ZQE2
KEGG IDelx:CDCO157_0215
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 6.00E-44, Aligned region: 139..154
DUF3702 [PF12486], Evalue: 6.00E-44, Aligned region: 292..436
ImpA-rel_N [PF06812], Evalue: 6.20E-21, Aligned region: 41..100
Protein Sequence: 469 a.a.     [Download]
>gi|387880774|ref|YP_006311076.1| hypothetical protein CDCO157_0215 [Escherichia coli Xuzhou21]
MNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPELNWKLVESLALAIFKANGVDLHTATYYTLAR
TRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLDWFNSRTGNILRQQISFAESDLPLIYRTERA
LQLICDKLQQVELKRVPRVENLLYFMQNTRKRLEPQLKSNTENAAQTTVRTLIYAPETQASSTPEAVVPP
LPGLPEMKVEVRSLTENPPQASVIKQGSTVRGFIAGIACSVAVASALWWWQVYPVQQQLLQVNDTAQGAA
TVWMASPELENYERRLQQLLDTSPVQPLETGMQMMRVADSRWPESLQQQQASTQWNEALKTRAQSSPQLR
GWLQTRQDLHAFADLVMQREKEGLTLSYIKNVIWQAERGLGQETPVESLLTQYQDARAQKQNTDALEKQI
NERLEGVLSRWLLLKNNTIPTIKKALNFNNIHEYKGVLNGEFNLFNTKW
 
Nucleotide Sequence: 1410 bp     [Download]
>gi|387880559|ref|NC_017906.1|:c245387-243978 Escherichia coli Xuzhou21 chromosome, complete genome
ATGAATAGTAACGTACTGACACAAACTATCGTTACCGGCAGTGACCCGCGCGGGCTGCCGGAATTCAGCG
CCATCCGCGAGGAAATAAACAAAGCCAGCCACCCGTCACAGCCTGAGCTGAACTGGAAACTGGTGGAGTC
GCTGGCGCTGGCGATTTTTAAAGCCAACGGTGTGGATTTACACACCGCCACCTACTATACGCTTGCCCGG
ACACGGACACAGGGACTGGCGGGATTCTGCGAAGGTGCGGAACTGCTGGCGGCAATGGTAAGCCACGACT
GGGATAAGTTCTGGCCGCAGGGCGGCCCGGCGCGTACTGAAATGCTGGACTGGTTTAACTCCCGAACCGG
CAATATTCTGCGTCAGCAAATCTCCTTTGCGGAATCCGACCTACCACTGATCTACCGCACAGAGCGGGCA
TTGCAGCTTATCTGCGATAAGCTCCAGCAGGTGGAACTGAAGCGCGTTCCGCGCGTGGAGAATCTGCTCT
ATTTTATGCAGAACACGCGTAAACGGCTTGAACCCCAGCTGAAGAGTAACACTGAGAACGCCGCACAGAC
CACGGTCAGAACGCTGATTTATGCCCCGGAAACACAGGCATCTTCCACACCAGAAGCGGTAGTGCCTCCC
CTGCCCGGCCTGCCTGAGATGAAAGTGGAAGTGCGCAGTCTGACAGAGAATCCCCCACAGGCCAGTGTGA
TAAAGCAAGGCAGTACGGTAAGAGGGTTTATCGCAGGGATCGCCTGTTCAGTGGCTGTCGCCTCAGCATT
GTGGTGGTGGCAGGTCTATCCGGTGCAGCAGCAACTGTTACAGGTTAACGACACCGCTCAGGGCGCAGCA
ACGGTGTGGATGGCCTCACCTGAACTCGAAAACTATGAGCGCAGGCTGCAACAACTTCTTGATACCTCCC
CGGTACAGCCGCTGGAAACCGGGATGCAGATGATGCGTGTTGCCGACAGTCGCTGGCCGGAAAGCCTGCA
ACAGCAACAGGCCTCGACACAATGGAATGAGGCACTCAAAACCCGCGCACAGAGTAGCCCGCAGTTGCGT
GGCTGGTTGCAGACCCGCCAGGACTTACATGCTTTTGCAGATCTAGTGATGCAGCGCGAGAAAGAGGGAC
TAACCCTTTCCTATATCAAAAATGTCATCTGGCAGGCGGAGCGGGGACTGGGGCAGGAAACACCCGTTGA
GTCTCTGTTGACGCAGTACCAGGATGCCCGTGCGCAGAAGCAGAATACAGATGCGCTGGAAAAACAAATT
AATGAGCGACTCGAAGGCGTGTTAAGCCGCTGGCTGCTGCTGAAGAATAATACGATACCGACGATAAAAA
AAGCATTGAATTTCAATAACATTCATGAATACAAAGGAGTTTTAAATGGCGAATTTAATTTATTTAACAC
TAAATGGTGA