SecReT6
Protein ID: 387880780
SecReT6 ID653
T6SS typei1
Gene symbol-
Locus tagCDCO157_0223
StrainEscherichia coli Xuzhou21
Repliconchromosome [GenBank: NC_017906] [Browse all T6SS(s) in this replicon]
Location [Strand]256005..256529 [-]
Productlipoprotein
NoteTssJ
UniProt IDI1ZQE8
KEGG IDelx:CDCO157_0223
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.90E-33, Aligned region: 13..167
Protein Sequence: 174 a.a.     [Download]
>gi|387880780|ref|YP_006311082.1| lipoprotein [Escherichia coli Xuzhou21]
MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSEITVTLLTEPDTNTNAEGESAAVDVQ
LVYLTDDSKLQAADYDQIASTPLPDVLGKNYIDHQDFNLLPDTIKTLPPIKLDEKTQFIGVVAYFSDDQA
TEWKQIETVEGTGHHYRLLVHVRQSSIEMKKEDE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|387880559|ref|NC_017906.1|:c256529-256005 Escherichia coli Xuzhou21 chromosome, complete genome
ATGAACAGGAAGGCGTTTCTGGCCTGCGTGCTGATGTGCGTCATATTAACCGGCTGCGAAACGGCGAAAA
AAATCAGCGAGGTGATCAAAAACCCGGATATCCAGGTCGGGAGCCTGAAGGAGCAACCTTCGGAAATAAC
CGTCACCCTGCTGACTGAACCGGACACCAATACCAATGCGGAGGGTGAATCAGCCGCCGTGGATGTGCAA
CTGGTGTACCTGACTGACGACTCAAAATTGCAGGCAGCCGACTATGACCAGATAGCCAGTACGCCGCTAC
CGGATGTGCTGGGTAAAAACTATATCGACCACCAGGATTTCAACCTGTTGCCGGACACCATCAAAACCCT
GCCGCCGATAAAGCTGGATGAGAAAACGCAGTTTATTGGTGTCGTGGCCTATTTCTCCGATGACCAGGCC
ACTGAATGGAAACAAATCGAGACGGTGGAAGGAACCGGCCACCATTACCGCCTGCTGGTGCATGTACGTC
AAAGCAGCATCGAAATGAAAAAAGAGGATGAATAA