SecReT6
Protein ID: 387880782
SecReT6 ID653
T6SS typei1
Gene symbol-
Locus tagCDCO157_0225
StrainEscherichia coli Xuzhou21
Repliconchromosome [GenBank: NC_017906] [Browse all T6SS(s) in this replicon]
Location [Strand]257831..258913 [-]
Producthypothetical protein
NoteTssG
UniProt IDI1ZQF0
KEGG IDelx:CDCO157_0225
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.30E-93, Aligned region: 33..347
Protein Sequence: 360 a.a.     [Download]
>gi|387880782|ref|YP_006311084.1| hypothetical protein CDCO157_0225 [Escherichia coli Xuzhou21]
MDGKNRAASSYLSPGNPPADKEQNDPLAQVFHNACSYNFFAMAELLHRLAKGEKGTPELSLRDDPAQETL
RFSADASLAFPCSDISALKRDTSGAFRMTTTFMGLQGSQSPLPGYYLDHLAWKAVHEQSPVGDFLDMFSH
RLTQFVWHIWRKYRYHISFRNGGVDAFSQRMYSLVGLGHRQLRDKLAINHSKMLAYSGILANPGRSPEII
CGLVSHCFDLSEVTLQNWQRRKVDIEPDQQNSLGSYSLKNGEKLAGRSVLGNFVLGTRVPDLSGKFQLSI
TSLTRKQFLSFLPSGENFLPLTTFVSFILRDQLAWDLHLGLAPEQVGAMRLGDNKSALLGWTSFLGTPEE
RPSVTIRVRS
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|387880559|ref|NC_017906.1|:c258913-257831 Escherichia coli Xuzhou21 chromosome, complete genome
ATGGACGGAAAGAATCGGGCAGCATCCTCTTATCTGAGTCCGGGAAATCCCCCGGCAGATAAAGAGCAGA
ATGATCCGCTGGCACAGGTTTTCCATAATGCCTGCTCTTACAATTTTTTTGCGATGGCGGAGCTGTTGCA
CCGCCTGGCAAAGGGTGAAAAGGGGACGCCAGAATTATCCCTGCGCGACGATCCGGCACAGGAAACCCTG
CGTTTCAGCGCCGATGCCAGCCTTGCCTTCCCGTGCAGTGATATCAGTGCGCTGAAACGGGATACGTCAG
GGGCATTCAGGATGACCACTACCTTTATGGGGTTACAGGGGAGCCAGTCGCCTCTCCCCGGTTATTACCT
CGATCACCTGGCCTGGAAAGCGGTACATGAACAAAGTCCGGTAGGTGATTTTCTGGATATGTTCAGCCAC
CGCCTGACCCAGTTTGTCTGGCATATCTGGCGTAAGTACCGCTATCACATCAGTTTTCGTAACGGCGGTG
TGGATGCGTTCTCGCAGCGCATGTACTCCCTTGTCGGGCTGGGCCACCGCCAGCTTCGCGATAAGCTGGC
GATTAATCACAGCAAAATGCTGGCGTATTCCGGGATCCTGGCAAATCCGGGACGATCCCCGGAAATTATC
TGTGGCCTGGTGTCCCACTGCTTTGATTTGTCAGAAGTGACGCTGCAAAACTGGCAACGTCGCAAGGTGG
ATATTGAACCGGATCAGCAAAACAGCCTGGGGAGCTATTCTCTTAAAAATGGCGAAAAACTGGCGGGAAG
ATCGGTACTGGGCAACTTTGTTCTGGGTACACGAGTACCCGATCTCAGCGGAAAATTCCAGCTCAGTATT
ACCAGCCTGACCCGAAAACAGTTCCTCTCTTTTCTGCCGTCCGGCGAAAACTTCCTGCCACTGACGACGT
TCGTGTCCTTCATCCTGCGCGATCAGCTTGCCTGGGACTTACATCTGGGGCTGGCGCCGGAGCAGGTGGG
CGCAATGCGCCTGGGCGATAACAAAAGTGCGCTGCTGGGCTGGACCAGCTTCCTCGGCACACCGGAAGAA
CGACCCTCAGTCACCATCAGGGTACGGTCGTAA