SecReT6
Protein ID: 387880784
SecReT6 ID653
T6SS typei1
Gene symbol-
Locus tagCDCO157_0227
StrainEscherichia coli Xuzhou21
Repliconchromosome [GenBank: NC_017906] [Browse all T6SS(s) in this replicon]
Location [Strand]260731..261144 [-]
Producthypothetical protein
NoteTssE
UniProt IDI1ZQF2
KEGG IDelx:CDCO157_0227
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-18, Aligned region: 29..118
Protein Sequence: 137 a.a.     [Download]
>gi|387880784|ref|YP_006311086.1| hypothetical protein CDCO157_0227 [Escherichia coli Xuzhou21]
MILDRERTTGSLFERMEASSARNRQGGSIHSLRQSIRQNLRNILNTRSGSCRGAPELGIDEPEGAENFRE
SMSRAIEQCIERYEPRISHAEVQAVVSSASSPLDMTFHITAWVTFNETHEVLEFDMAPNGSQHYRVD
 
Nucleotide Sequence: 414 bp     [Download]
>gi|387880559|ref|NC_017906.1|:c261144-260731 Escherichia coli Xuzhou21 chromosome, complete genome
ATGATACTGGATCGGGAAAGAACCACAGGTTCTCTTTTTGAGCGTATGGAAGCCTCTTCGGCCAGAAACC
GGCAGGGAGGCAGTATTCATTCGCTCAGGCAATCCATTCGCCAGAACCTAAGAAACATTCTTAATACCCG
GTCCGGTAGTTGCCGGGGTGCGCCTGAGCTGGGCATTGATGAACCGGAAGGGGCTGAAAACTTCCGCGAA
TCCATGAGTCGGGCCATCGAGCAATGTATAGAACGCTATGAACCCCGGATCTCACACGCTGAAGTGCAGG
CAGTGGTTTCATCCGCCTCCAGCCCGCTGGATATGACGTTTCATATTACAGCCTGGGTGACATTTAACGA
AACGCATGAGGTGCTTGAATTTGATATGGCACCGAATGGCAGCCAGCATTACCGGGTGGACTGA