SecReT6
Protein ID: 387880787
SecReT6 ID653
T6SS typei1
Gene symbol-
Locus tagCDCO157_0230
StrainEscherichia coli Xuzhou21
Repliconchromosome [GenBank: NC_017906] [Browse all T6SS(s) in this replicon]
Location [Strand]262936..263436 [-]
Producthypothetical protein
NoteTssB
UniProt IDI1ZQF5
KEGG IDelx:CDCO157_0230
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.70E-55, Aligned region: 7..162
Protein Sequence: 166 a.a.     [Download]
>gi|387880787|ref|YP_006311089.1| hypothetical protein CDCO157_0230 [Escherichia coli Xuzhou21]
MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNTQETSSLDERQAVSVNKHNFGAVMAE
AAIGLNFTVPATLKGSTTDDEMNVALNIKSLDDFSPDSVARQVPEVNKLLELREALTALKGPMGNLPAFR
TQLQALLENEESREQLLKEIGQVSNK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|387880559|ref|NC_017906.1|:c263436-262936 Escherichia coli Xuzhou21 chromosome, complete genome
ATGAGCAAAAAATTTGAAGGCAGCGTCGCGCCTCGCGAACGTATTAATATATCGTATGTCCCAAAAACAG
ATGGCCAGACGGCTGAAGTGGAACTTCCGCTTAACATGCTCGTTGTCGGCGATACCGGAAATACGCAGGA
AACATCCTCACTGGATGAACGTCAGGCAGTTTCCGTTAACAAGCACAATTTCGGTGCAGTGATGGCTGAA
GCAGCCATTGGCCTCAATTTTACCGTCCCCGCCACGCTGAAGGGAAGCACAACGGACGATGAAATGAATG
TGGCGCTGAATATCAAGTCACTGGATGATTTTTCACCAGATAGCGTGGCCCGGCAGGTTCCGGAAGTGAA
TAAATTGCTGGAACTGCGTGAAGCACTGACTGCACTGAAGGGGCCGATGGGTAACCTTCCGGCATTCCGT
ACCCAGCTCCAGGCATTGCTGGAAAATGAAGAGTCCCGCGAGCAGTTGCTCAAAGAAATCGGCCAGGTGA
GCAATAAATAA