SecReT6
Protein ID: 387888465
SecReT6 ID655
T6SS typei2
Gene symbol-
Locus tagEBL_c11480
StrainEscherichia blattae DSM 4481
Repliconchromosome [GenBank: NC_017910] [Browse all T6SS(s) in this replicon]
Location [Strand]1179502..1179999 [+]
Producthypothetical protein
NoteTssB
UniProt IDI2B6U8
KEGG IDebt:EBL_c11480
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.90E-49, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|387888465|ref|YP_006318763.1| hypothetical protein EBL_c11480 [Shimwellia blattae DSM 4481 = NBRC 105725]
MAESFQNEVPKARINLKLDLHTGGASKKTELPLKLLIAGDFSNGQESAPLPERKKVNLNKNNIDAVLFEY
SPKVNLTVKNTLAGDGSEDNISLIFRSMKDFSPEQVSRQIPQLKAMLSMRNLLRDLKANLLDNQAFRKEL
EKILLDPALSAELREELSALAPKQP
 
Nucleotide Sequence: 498 bp     [Download]
>gi|387887350|ref|NC_017910.1|:1179502-1179999 Escherichia blattae DSM 4481 chromosome, complete genome
ATGGCTGAGAGTTTCCAGAATGAAGTGCCCAAAGCACGTATTAATCTAAAACTTGACCTGCATACGGGGG
GCGCAAGCAAGAAAACTGAACTTCCCCTGAAATTACTTATTGCAGGCGACTTCAGTAATGGTCAGGAGTC
CGCGCCATTACCGGAGCGTAAAAAAGTTAATCTGAACAAAAATAATATTGATGCAGTTCTTTTCGAATAT
TCTCCAAAAGTAAACCTTACCGTTAAAAATACGCTGGCCGGTGACGGTAGCGAAGACAATATCAGCCTGA
TATTCCGGAGCATGAAGGATTTCTCTCCGGAGCAGGTCTCCCGGCAAATACCTCAGCTCAAGGCGATGCT
TTCCATGCGCAATTTGCTGCGCGATTTAAAAGCAAACCTGCTGGACAACCAGGCCTTCCGAAAAGAGCTG
GAGAAGATCCTGCTCGACCCGGCATTAAGCGCCGAACTCCGGGAGGAGCTCTCCGCCCTGGCACCGAAAC
AGCCATAA