SecReT6
Protein ID: 387888466
SecReT6 ID655
T6SS typei2
Gene symbol-
Locus tagEBL_c11490
StrainEscherichia blattae DSM 4481
Repliconchromosome [GenBank: NC_017910] [Browse all T6SS(s) in this replicon]
Location [Strand]1180039..1181580 [+]
Producthypothetical protein
NoteTssC
UniProt IDI2B6U9
KEGG IDebt:EBL_c11490
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.00E-174, Aligned region: 87..509
Protein Sequence: 513 a.a.     [Download]
>gi|387888466|ref|YP_006318764.1| hypothetical protein EBL_c11490 [Shimwellia blattae DSM 4481 = NBRC 105725]
MSVKNEHAAGGESVVLERPAAGGVYASLFEKINLSPVSELSALDIWQDAQAMSDATADERLTAGMQVFLE
CLKKSGSKIEKLDKTLIDHHIAELDYQISRQLDAVMHSEEFQAVESLWRGVKSLVDKTDFRQNVKVELLD
MSKEDLRQDFEDSPEIVQSGLYKHTYIDEYDTPGGEPIAALISAYEFDASAQDVALLRNISKVSAAAHMP
FIGSAGPTFFFRDSMEDVAAIKDIGNYFDRAEYIKWKSFRETDDARYIGLVMPRVLGRLPYGPDTVPVRS
FNYVEEVKGPDHNKYLWTSAAFAFASNMVRSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIPS
EVMIPETREFEFASLGFIPLSYYKNRDYACFFSANSTQKPALYDTADATANSRINARLPYIFLLSRIAHY
LKMIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDARVVVEDIEDNPGFFRVKLYAI
PHFQVEGMDVNLSLVSRMPKAKS
 
Nucleotide Sequence: 1542 bp     [Download]
>gi|387887350|ref|NC_017910.1|:1180039-1181580 Escherichia blattae DSM 4481 chromosome, complete genome
ATGTCTGTAAAAAATGAGCATGCCGCTGGCGGCGAGAGTGTGGTACTTGAGCGCCCTGCCGCGGGCGGGG
TTTATGCGTCCCTGTTTGAAAAAATCAATCTCAGCCCGGTGTCTGAGCTGAGCGCCCTGGATATCTGGCA
GGATGCGCAGGCGATGTCGGATGCCACCGCTGATGAGCGGTTAACCGCCGGAATGCAGGTGTTCCTGGAG
TGCCTTAAAAAATCGGGCTCAAAAATTGAAAAGCTCGATAAAACGCTGATTGATCACCATATCGCGGAGC
TGGACTACCAGATTAGCCGCCAGCTGGATGCGGTAATGCACAGCGAAGAATTTCAGGCGGTGGAGAGCCT
GTGGCGCGGCGTGAAGTCGCTGGTCGATAAAACGGATTTTCGCCAGAACGTGAAAGTGGAACTCCTGGAT
ATGTCGAAAGAGGATCTGCGCCAGGACTTCGAAGACAGCCCGGAAATTGTCCAGAGCGGGTTGTATAAAC
ACACCTATATTGATGAGTACGACACCCCGGGCGGCGAGCCGATTGCGGCACTGATTTCCGCTTATGAATT
TGACGCATCCGCCCAGGATGTTGCCCTGCTGCGCAATATTTCGAAAGTGTCTGCCGCCGCGCATATGCCG
TTTATCGGCTCCGCAGGCCCGACGTTTTTCTTCCGGGACTCCATGGAAGATGTGGCGGCCATCAAGGATA
TCGGTAACTACTTTGACCGCGCCGAGTACATCAAGTGGAAATCCTTCCGTGAGACCGACGACGCCCGCTA
TATCGGCCTGGTGATGCCGCGCGTACTGGGCCGCCTGCCGTATGGTCCGGACACCGTGCCGGTGCGCAGT
TTTAACTACGTTGAAGAAGTGAAAGGCCCGGACCACAACAAATATCTCTGGACCAGTGCCGCTTTCGCTT
TTGCATCCAACATGGTGCGCAGCTTCATTAACAACGGCTGGTGTGTCCAGATCCGTGGCCCACAGGCCGG
TGGTGCGGTGCAGGATCTGCCCATCCATCTGTACGATCTGGGGACCGGGAATCAGGTGAAGATCCCGTCT
GAAGTGATGATTCCGGAGACCCGCGAATTTGAATTCGCCAGCCTGGGGTTCATCCCTTTGTCGTACTACA
AAAACCGCGACTACGCGTGCTTCTTCTCGGCAAACTCCACCCAGAAACCGGCGCTGTATGACACTGCGGA
TGCGACGGCGAACAGCCGCATCAACGCCCGCCTGCCGTACATCTTCCTGCTGTCGCGTATCGCCCATTAC
CTGAAGATGATTCAGCGTGAAAACATCGGCACCACCAAGGACCGGCGTTTGCTGGAGCTGGAGCTTAACA
CCTGGGTGCGCAGCCTGGTGACGGAGATGACCGATCCGGGCGACGAGCTGCAGGCTTCTCACCCGCTGCG
TGATGCCAGAGTGGTGGTGGAAGACATTGAGGATAACCCGGGGTTCTTCCGCGTGAAGCTGTACGCCATC
CCGCACTTCCAGGTGGAAGGTATGGACGTCAACCTGTCACTGGTTTCCCGGATGCCGAAGGCGAAATCGT
AA