SecReT6
Protein ID: 387888467
SecReT6 ID655
T6SS typei2
Gene symbol-
Locus tagEBL_c11500
StrainEscherichia blattae DSM 4481
Repliconchromosome [GenBank: NC_017910] [Browse all T6SS(s) in this replicon]
Location [Strand]1181599..1182948 [+]
Producthypothetical protein
NoteTssK
UniProt IDI2B6V0
KEGG IDebt:EBL_c11500
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.30E-118, Aligned region: 18..446
Protein Sequence: 449 a.a.     [Download]
>gi|387888467|ref|YP_006318765.1| hypothetical protein EBL_c11500 [Shimwellia blattae DSM 4481 = NBRC 105725]
MKIHRPLWNEGALLAPQQFQQQSEWDAFSRAGIAARGNVFPWGVGRVELDEAMLASGRVQAQLLRLWLPD
DTLVDTRCSDLPPEPREIGAPDSASNAPVTVYVALPVMQAGIVNVQTDTVPAERPLRYREAWETIADCFG
QEEEPMAVARFNLAFRFGHEDNGAWDTCAIARLLPDGQGGWRQDPDFIPPMALFSASRHLCERLALLNRQ
LRSRRQRLMSMRRESNDRMADFAVADVSLFWLLNALNSHARVLSEYARFPDRHPEQVWGELARLAGSMLT
FSLEHDLDAIPGYDHLAPEKTFPPLFDLISELLEASLPSRVVAVRMDRLEPETWKAVLHDIRLRDEADFY
LSVRANQPAWQIAERFAEVCIAGAPASVGEVSGLAVEGIGLIALNRVPAVLPVRLENQYFVLDMECDAAR
EMLDQGVCVFYVPSVLGELDLELFAVLRS
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|387887350|ref|NC_017910.1|:1181599-1182948 Escherichia blattae DSM 4481 chromosome, complete genome
ATGAAAATTCATCGTCCGTTATGGAATGAAGGGGCGCTTCTGGCCCCTCAACAATTTCAGCAACAATCTG
AATGGGATGCATTTTCCCGGGCCGGTATTGCCGCCCGTGGAAATGTCTTTCCCTGGGGGGTTGGTCGGGT
AGAGCTGGATGAAGCGATGCTGGCCTCCGGTCGCGTCCAGGCGCAGTTACTTCGTCTCTGGCTCCCGGAT
GACACGCTGGTTGATACCCGGTGCAGCGATCTGCCACCGGAGCCGCGTGAAATCGGGGCACCGGATTCGG
CCAGCAATGCCCCGGTGACGGTATATGTGGCGTTGCCTGTGATGCAGGCCGGGATCGTGAATGTGCAGAC
GGACACGGTCCCGGCTGAGCGCCCGCTGCGTTATCGGGAAGCCTGGGAGACGATCGCCGATTGTTTCGGT
CAGGAAGAAGAGCCGATGGCGGTGGCCCGCTTTAACCTGGCATTCCGTTTCGGACATGAAGACAACGGCG
CCTGGGATACCTGCGCCATTGCCCGTCTGTTGCCGGACGGGCAGGGGGGCTGGCGTCAGGATCCTGACTT
TATCCCGCCGATGGCGCTGTTCTCGGCAAGTCGTCATCTGTGTGAGCGCCTGGCACTGCTGAATCGCCAG
CTGCGCTCCCGCCGTCAGCGTCTGATGTCCATGCGCCGTGAGAGCAACGACAGGATGGCTGATTTTGCAG
TCGCTGATGTTTCGCTTTTCTGGCTGCTGAATGCCCTGAATTCGCATGCCCGTGTGCTCTCTGAGTATGC
GCGTTTCCCTGACAGGCATCCTGAGCAGGTCTGGGGCGAGCTGGCTCGTCTTGCCGGCAGTATGCTGACT
TTCTCGCTTGAGCACGATCTGGATGCCATTCCGGGTTATGACCACCTCGCGCCGGAGAAAACCTTCCCGC
CACTCTTCGACCTTATCAGCGAACTGCTGGAAGCCAGCCTGCCATCACGCGTGGTGGCTGTCCGTATGGA
TCGCCTGGAGCCCGAAACCTGGAAGGCGGTGTTGCACGATATTCGTCTGCGCGATGAAGCCGATTTCTAT
CTCTCCGTTCGGGCAAACCAGCCAGCCTGGCAGATTGCTGAACGCTTCGCCGAAGTCTGTATTGCCGGTG
CCCCGGCAAGTGTGGGCGAAGTGTCCGGTCTGGCTGTTGAAGGTATTGGCCTCATTGCCCTGAACCGCGT
GCCTGCTGTGCTGCCGGTGCGTCTGGAGAACCAGTACTTTGTGCTGGATATGGAGTGTGATGCCGCCCGT
GAAATGCTGGATCAGGGGGTCTGCGTCTTCTATGTTCCGTCCGTGCTCGGCGAACTTGATCTCGAACTGT
TTGCGGTGCTGCGCTCATGA