SecReT6
Protein ID: 387888468
SecReT6 ID655
T6SS typei2
Gene symbol-
Locus tagEBL_c11510
StrainEscherichia blattae DSM 4481
Repliconchromosome [GenBank: NC_017910] [Browse all T6SS(s) in this replicon]
Location [Strand]1182945..1183697 [+]
Producthypothetical protein
NoteTssL
UniProt IDI2B6V1
KEGG IDebt:EBL_c11510
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.80E-39, Aligned region: 7..77
DUF2077 [PF09850], Evalue: 1.80E-39, Aligned region: 113..238
Protein Sequence: 250 a.a.     [Download]
>gi|387888468|ref|YP_006318766.1| hypothetical protein EBL_c11510 [Shimwellia blattae DSM 4481 = NBRC 105725]
MIKDFDIDALLAETWLTVAQLRHGGRVTDGPVLYAACKAQVESVREALDRAGFDAESIDHITYAQCALLD
ETVLNRRPEPKNAVVEVRGTDATESHSTDETSRDALNMASLDEGQRTWRSAPLQTVYFGSLRAGEALYDR
IAEILRHPAPEPAVLACYQRVLALGFQGQYRLSGMGQSRRDEVIAALNERVPPLETGTSLVVQKTGRRRY
NLLRSIWFWIVLAALLTGAVWLGGHLWLQDLLHQQLPEQP
 
Nucleotide Sequence: 753 bp     [Download]
>gi|387887350|ref|NC_017910.1|:1182945-1183697 Escherichia blattae DSM 4481 chromosome, complete genome
ATGATAAAGGACTTCGACATTGATGCCCTGTTGGCAGAAACCTGGCTCACCGTGGCGCAATTGCGTCACG
GCGGGCGGGTAACGGATGGCCCGGTGCTTTATGCCGCGTGTAAAGCGCAGGTGGAGAGCGTGCGCGAGGC
GCTGGACAGGGCCGGGTTTGATGCAGAAAGTATCGATCACATTACCTACGCCCAGTGTGCTCTGCTGGAT
GAAACCGTTCTGAATCGCAGGCCGGAGCCGAAAAATGCAGTCGTGGAGGTCAGGGGAACAGACGCCACAG
AAAGCCATTCCACTGATGAAACGTCCCGTGACGCGCTGAACATGGCCTCGCTGGACGAGGGGCAGAGAAC
CTGGCGTTCAGCTCCGTTGCAGACGGTGTACTTTGGCTCACTGCGTGCCGGTGAAGCGCTGTATGACCGC
ATCGCGGAGATACTGCGACACCCCGCGCCTGAGCCTGCCGTGCTGGCCTGTTACCAGCGGGTGCTGGCAC
TCGGTTTCCAGGGGCAGTACCGGTTGTCCGGCATGGGGCAGTCCCGTCGTGATGAGGTTATTGCAGCACT
GAATGAGCGCGTGCCGCCGCTTGAGACCGGCACCTCTCTGGTGGTGCAGAAGACCGGGAGACGTCGTTAC
AACTTGCTGCGTTCCATCTGGTTCTGGATTGTGCTGGCGGCGCTCCTGACTGGTGCTGTGTGGCTGGGTG
GTCATCTGTGGTTGCAGGACTTGCTGCACCAGCAACTGCCGGAGCAGCCCTGA