SecReT6
Protein ID: 387888469
SecReT6 ID655
T6SS typei2
Gene symbol-
Locus tagEBL_c11520
StrainEscherichia blattae DSM 4481
Repliconchromosome [GenBank: NC_017910] [Browse all T6SS(s) in this replicon]
Location [Strand]1183697..1185379 [+]
Productputative OmpA family protein
NoteTagL
UniProt IDI2B6V2, I2B6V2
KEGG IDebt:EBL_c11520
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 6.40E-16, Aligned region: 430..526
Protein Sequence: 560 a.a.     [Download]
>gi|387888469|ref|YP_006318767.1| putative OmpA family protein [Shimwellia blattae DSM 4481 = NBRC 105725]
MRGRILARAALPVLLCLIAVLWLVWGFLTWPVAGKSALTLPVMLISAAIICRRYRQKRPALQVDEAGYFP
PEGHTGPVVLVCGDVDDAMFAGGPGRGTAQGWYLRVAELTGLIPFAERLVARTPTMAGQLAVMYRCLPDQ
HEDEALLRASLKALRLQMKPLRELTGYSVPLILNSEFSGPETPWIVVRGNTALVCPEDEPAVILSEWQQS
SQTAFIQPYLTQATSLLHSVMLDELGKADRLCPAVRPFAVTLRLGSVATSTAALWPQLLFRQTPIAPAGR
VTVYEPRWHFADAVLPLLAPYTTPLQSGKTGRQVVMVLLLCTLGAIALSVRHNQSLIRKVSADLQRWQAI
PMNHYAPKAQALFALQQDALLLERWQRQGEPHRYGLGLYPGNRLWLAVQQAIDTWVPPPPPSNPKPKPVS
KIVRLDSISLFDPGQSVLKTGSTKMLVQSLVGIKAKPGWLIVVSGHTDNTGNPQLNQTLSLKRAEAVRDW
MRDTGDVPETCFAVQAYGASRPVATNDTREGRALNRRVEISLVPQADACQIPGHTPASSQDDGASQHNGE
 
Nucleotide Sequence: 1683 bp     [Download]
>gi|387887350|ref|NC_017910.1|:1183697-1185379 Escherichia blattae DSM 4481 chromosome, complete genome
ATGCGTGGACGAATACTTGCCCGGGCTGCCCTGCCTGTATTGCTGTGCCTTATCGCAGTGTTGTGGCTGG
TCTGGGGATTTCTCACATGGCCAGTTGCAGGCAAATCGGCGCTGACGCTGCCCGTTATGCTGATATCAGC
TGCTATTATCTGCCGGCGTTACCGTCAAAAACGGCCAGCACTGCAGGTTGATGAAGCTGGTTACTTCCCG
CCTGAAGGCCATACAGGACCGGTGGTGCTGGTGTGCGGAGATGTGGATGATGCCATGTTTGCCGGAGGCC
CGGGCCGGGGCACCGCACAGGGGTGGTATCTCCGGGTAGCGGAACTGACCGGGCTTATCCCTTTTGCAGA
GCGTCTGGTGGCCCGCACCCCAACGATGGCAGGCCAGCTCGCCGTGATGTACCGCTGCCTGCCGGACCAG
CATGAGGATGAGGCGTTGTTACGCGCATCCCTGAAAGCGCTGCGCCTGCAGATGAAGCCGTTGCGGGAAC
TGACCGGCTATAGCGTACCGCTGATCCTGAATAGCGAATTCAGCGGTCCGGAAACACCCTGGATAGTGGT
GCGGGGCAATACGGCTCTTGTGTGCCCGGAAGATGAGCCTGCCGTCATCCTCAGCGAATGGCAGCAGTCT
TCGCAGACGGCCTTTATTCAGCCGTACCTGACCCAGGCGACATCACTGCTTCACTCCGTGATGCTGGATG
AGCTGGGCAAAGCGGACAGGCTGTGCCCGGCCGTACGACCCTTTGCTGTTACTCTGCGTCTCGGGTCGGT
AGCCACCTCGACAGCCGCGCTGTGGCCACAATTATTGTTCCGCCAGACCCCCATTGCCCCAGCCGGTCGT
GTCACGGTGTATGAACCGCGCTGGCATTTTGCCGATGCGGTACTTCCTCTGCTGGCCCCTTATACCACCC
CGTTGCAGAGTGGAAAAACCGGGCGTCAGGTGGTGATGGTTCTGCTGTTATGCACCCTGGGTGCCATTGC
CCTGTCTGTGCGCCATAACCAGTCACTTATTCGCAAGGTCAGCGCCGACCTTCAGCGCTGGCAGGCCATC
CCGATGAACCACTATGCCCCGAAAGCGCAGGCCCTGTTTGCCCTGCAGCAGGATGCGTTGTTGCTGGAAC
GCTGGCAGCGTCAGGGAGAACCCCACCGCTACGGGCTTGGGCTGTATCCGGGCAACCGCCTGTGGCTGGC
GGTGCAGCAGGCCATTGATACCTGGGTGCCTCCACCGCCTCCATCAAATCCGAAGCCAAAGCCGGTATCG
AAAATTGTCCGTCTCGACAGTATATCGCTGTTCGACCCTGGCCAGTCTGTGCTGAAAACCGGCTCCACCA
AAATGCTGGTGCAGTCACTGGTCGGCATCAAAGCGAAGCCGGGCTGGCTGATTGTTGTGTCCGGCCATAC
CGACAACACCGGCAACCCGCAACTGAACCAGACGCTCTCCCTGAAGCGTGCCGAAGCGGTACGCGACTGG
ATGCGTGACACCGGCGATGTGCCGGAAACCTGTTTTGCGGTACAGGCCTATGGCGCAAGCCGTCCTGTCG
CAACCAACGACACCCGGGAGGGCCGTGCGCTCAACCGCCGTGTCGAAATCAGTCTGGTACCGCAGGCCGA
TGCCTGTCAGATACCGGGCCACACCCCGGCGTCATCGCAGGATGATGGCGCATCACAACACAATGGAGAG
TAA