SecReT6
Protein ID: 387888470
SecReT6 ID655
T6SS typei2
Gene symbol-
Locus tagEBL_c11530
StrainEscherichia blattae DSM 4481
Repliconchromosome [GenBank: NC_017910] [Browse all T6SS(s) in this replicon]
Location [Strand]1185384..1185875 [+]
Producthypothetical protein
NoteTssD
UniProt IDI2B6V3
KEGG IDebt:EBL_c11530
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.40E-36, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|387888470|ref|YP_006318768.1| hypothetical protein EBL_c11530 [Shimwellia blattae DSM 4481 = NBRC 105725]
MAIPVYLWLKDDGGADIKGSVDVQDRDGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFRWYKINDAGQEVEYFNTRLENVKVVKVNPVMHDIKDPSYEKHNHLEQIELRYE
KITWTYKDGNIIHSDSWNERATA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|387887350|ref|NC_017910.1|:1185384-1185875 Escherichia blattae DSM 4481 chromosome, complete genome
ATGGCAATTCCTGTTTATCTCTGGCTGAAAGACGACGGCGGCGCGGACATCAAAGGGTCTGTCGACGTTC
AGGATCGTGACGGCAGCATCGAAGTGGTGGCGCAGGAGCATAACCTGTACATCCCGACCGACAACAACAC
CGGCAAGCTGACCGGTACCCGTATTCATACCCCGTTCCTGTTTACCAAGGAAATCGACTCCTCCAGTCCG
TATCTGTACAAGGCGGTGACCACCGGCCAGACCCTGAAGTCTGCGGAATTCAGGTGGTACAAAATCAACG
ATGCGGGCCAGGAAGTGGAGTATTTCAACACCAGGCTCGAAAACGTGAAAGTGGTGAAAGTGAACCCGGT
GATGCACGACATCAAGGATCCGTCCTACGAGAAGCACAATCACCTCGAACAGATTGAGCTGCGTTACGAA
AAAATCACCTGGACCTATAAAGACGGCAACATTATTCATTCCGATTCCTGGAACGAACGCGCCACCGCCT
GA