SecReT6
Protein ID: 387888471
SecReT6 ID655
T6SS typei2
Gene symbol-
Locus tagEBL_c11540
StrainEscherichia blattae DSM 4481
Repliconchromosome [GenBank: NC_017910] [Browse all T6SS(s) in this replicon]
Location [Strand]1186153..1188798 [+]
Producthypothetical protein
NoteTssH
UniProt IDI2B6V4
KEGG IDebt:EBL_c11540
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.60E-41, Aligned region: 236..255
AAA_2 [PF07724], Evalue: 7.60E-41, Aligned region: 606..771
AAA [PF00004], Evalue: 5.30E-19, Aligned region: 238..350
AAA [PF00004], Evalue: 5.30E-19, Aligned region: 611..729
AAA [PF00004], Evalue: 5.30E-19, Aligned region: 759..776
AAA_5 [PF07728], Evalue: 1.60E-14, Aligned region: 109..166
AAA_5 [PF07728], Evalue: 1.60E-14, Aligned region: 238..258
AAA_5 [PF07728], Evalue: 1.60E-14, Aligned region: 336..368
AAA_5 [PF07728], Evalue: 1.60E-14, Aligned region: 610..731
ClpB_D2-small [PF10431], Evalue: 2.80E-12, Aligned region: 777..851
AAA_16 [PF13191], Evalue: 3.10E-11, Aligned region: 142..205
AAA_16 [PF13191], Evalue: 3.10E-11, Aligned region: 215..259
AAA_16 [PF13191], Evalue: 3.10E-11, Aligned region: 283..316
AAA_16 [PF13191], Evalue: 3.10E-11, Aligned region: 499..513
AAA_16 [PF13191], Evalue: 3.10E-11, Aligned region: 593..634
AAA_16 [PF13191], Evalue: 3.10E-11, Aligned region: 674..704
AAA_16 [PF13191], Evalue: 3.10E-11, Aligned region: 749..802
AAA_22 [PF13401], Evalue: 4.00E-09, Aligned region: 237..323
AAA_22 [PF13401], Evalue: 4.00E-09, Aligned region: 357..398
AAA_22 [PF13401], Evalue: 4.00E-09, Aligned region: 607..645
AAA_25 [PF13481], Evalue: 5.00E-08, Aligned region: 238..262
AAA_25 [PF13481], Evalue: 5.00E-08, Aligned region: 292..326
AAA_25 [PF13481], Evalue: 5.00E-08, Aligned region: 606..639
Arch_ATPase [PF01637], Evalue: 6.60E-07, Aligned region: 216..253
Arch_ATPase [PF01637], Evalue: 6.60E-07, Aligned region: 290..388
Arch_ATPase [PF01637], Evalue: 6.60E-07, Aligned region: 603..624
Arch_ATPase [PF01637], Evalue: 6.60E-07, Aligned region: 680..692
IstB_IS21 [PF01695], Evalue: 2.60E-06, Aligned region: 232..295
IstB_IS21 [PF01695], Evalue: 2.60E-06, Aligned region: 610..628
Zeta_toxin [PF06414], Evalue: 6.20E-06, Aligned region: 232..262
Zeta_toxin [PF06414], Evalue: 6.20E-06, Aligned region: 597..650
NACHT [PF05729], Evalue: 7.40E-06, Aligned region: 238..269
NACHT [PF05729], Evalue: 7.40E-06, Aligned region: 610..628
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 235..261
AAA_19 [PF13245], Evalue: 1.30E-05, Aligned region: 606..628
Sigma54_activat [PF00158], Evalue: 2.30E-05, Aligned region: 222..252
Sigma54_activat [PF00158], Evalue: 2.30E-05, Aligned region: 609..727
AAA_17 [PF13207], Evalue: 2.70E-05, Aligned region: 54..102
AAA_17 [PF13207], Evalue: 2.70E-05, Aligned region: 238..301
AAA_17 [PF13207], Evalue: 2.70E-05, Aligned region: 609..645
Clp_N [PF02861], Evalue: 3.80E-05, Aligned region: 22..58
Clp_N [PF02861], Evalue: 3.80E-05, Aligned region: 107..123
AAA_29 [PF13555], Evalue: 0.00013, Aligned region: 232..254
AAA_29 [PF13555], Evalue: 0.00013, Aligned region: 606..636
AAA_14 [PF13173], Evalue: 0.00024, Aligned region: 238..328
AAA_14 [PF13173], Evalue: 0.00024, Aligned region: 608..692
ABC_tran [PF00005], Evalue: 0.001, Aligned region: 52..181
ABC_tran [PF00005], Evalue: 0.001, Aligned region: 238..258
ABC_tran [PF00005], Evalue: 0.001, Aligned region: 478..512
ABC_tran [PF00005], Evalue: 0.001, Aligned region: 609..633
AAA_18 [PF13238], Evalue: 0.0016, Aligned region: 238..258
AAA_18 [PF13238], Evalue: 0.0016, Aligned region: 611..630
DUF258 [PF03193], Evalue: 0.0018, Aligned region: 221..255
DUF258 [PF03193], Evalue: 0.0018, Aligned region: 608..622
AAA_23 [PF13476], Evalue: 0.002, Aligned region: 119..161
AAA_23 [PF13476], Evalue: 0.002, Aligned region: 238..255
AAA_23 [PF13476], Evalue: 0.002, Aligned region: 472..533
AAA_23 [PF13476], Evalue: 0.002, Aligned region: 607..633
SRP54 [PF00448], Evalue: 0.0025, Aligned region: 238..260
SRP54 [PF00448], Evalue: 0.0025, Aligned region: 609..640
RNA_helicase [PF00910], Evalue: 0.0033, Aligned region: 239..260
RNA_helicase [PF00910], Evalue: 0.0033, Aligned region: 611..631
RNA_helicase [PF00910], Evalue: 0.0033, Aligned region: 708..729
NUC173 [PF08161], Evalue: 0.01, Aligned region: 718..794
Protein Sequence: 881 a.a.     [Download]
>gi|387888471|ref|YP_006318769.1| hypothetical protein EBL_c11540 [Shimwellia blattae DSM 4481 = NBRC 105725]
MENPAILLRRLNPYCARAMEGAASLCQTRAHAEILPEHWLLKLLEQGEGDLTVLARRYEWDMDALWQDLL
GWLDKQPRSVRQRPQLSENIQALMQEAWLIASLNSEEQIRSVHLLMALAEKQSLVRCDGLWMLLTLGQSQ
LERLRPLLDAQSDERPEVQQEAELARNHGGEVELAGHPADADVNAGELSPALQNALDKFTLDITAKAKAG
NIDPVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPESLKPVVLRTLDLGLL
QAGAGVKGEFEQRLKNVIDAVQQSPVPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATT
WSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKSRYAEHHNVHITDGAVRAAVTLSRRYLTGRQ
LPDKAVDLLDTASARVRMSLDTVPEPLTRIRAQITALEMEKQALLEDIAVGNQNHDERLAAIEQEENSLI
VELDVLETRYGEALKFTGQLLESRQDISRQGETRQLQQALNSMQLLPVDVDARTVATVIADWTGVPLSSL
MKDEQTELLTLENEIGKRVVGQDVALVAIAQRLRAAKTGLTSENGPQGVFLLVGPSGVGKTETALALADV
MYGGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVMNLFY
QVFDRGFMRDGEGREIDFRNTVIMMTSNLGSDHLMQLLDEQPDASEGDLHELLRPILRDHFQPALLARFQ
TVIYRPLAEAAMRTIVEMKLSQVSKRLYRHYGLTTHIDRGLYDALTAACLLPDTGARNVDSLLSQQILPV
LSQQLLTYMAAKQKPHSLTLGWNDEEGIGLEFDATDTTGEA
 
Nucleotide Sequence: 2646 bp     [Download]
>gi|387887350|ref|NC_017910.1|:1186153-1188798 Escherichia blattae DSM 4481 chromosome, complete genome
ATGGAAAACCCGGCAATTCTCCTTCGGCGTCTGAACCCTTATTGTGCCCGCGCGATGGAGGGGGCCGCCT
CGCTCTGCCAGACTCGCGCCCATGCGGAAATCCTGCCGGAGCACTGGCTGCTGAAGCTGCTGGAGCAGGG
GGAAGGGGATCTGACCGTACTGGCACGCCGCTACGAATGGGATATGGACGCGCTGTGGCAGGATTTGCTG
GGCTGGCTGGATAAACAGCCGCGCTCGGTACGCCAGCGCCCGCAGCTCTCGGAAAATATTCAGGCACTGA
TGCAGGAAGCCTGGCTGATTGCCTCGCTCAACAGTGAAGAGCAGATCCGCAGTGTTCACCTGCTGATGGC
GCTGGCCGAAAAACAGAGCCTGGTGCGCTGCGATGGGCTGTGGATGTTGCTGACACTGGGCCAGAGCCAG
CTGGAGCGTCTGCGTCCGCTGCTTGATGCGCAGTCTGATGAGCGCCCCGAGGTGCAGCAGGAAGCGGAAC
TGGCCCGGAACCATGGTGGGGAGGTAGAGCTTGCCGGGCACCCTGCCGATGCGGATGTCAACGCGGGGGA
GCTTAGTCCGGCCCTGCAAAACGCGCTGGATAAATTCACCCTTGATATCACAGCAAAAGCGAAAGCGGGC
AACATCGATCCGGTATTTGGCCGTGATACTGAAATCCGCCAGATGGTGGATATTCTCTCCCGGCGTCGCA
AGAACAACCCGATCCTGGTGGGGGAGCCGGGCGTTGGCAAAACTGCGCTGGTGGAAGGGCTCGCGCTGCG
TATTGCCGAAGGTAACGTGCCGGAGTCGCTCAAACCTGTTGTTCTGCGCACTCTTGACCTTGGCCTGTTG
CAGGCGGGCGCAGGGGTGAAAGGCGAATTTGAACAGCGCCTGAAAAACGTAATTGACGCTGTGCAGCAGT
CACCGGTGCCGGTGCTGCTGTTTATCGACGAAGCCCACACCATCATTGGTGCCGGTAATCAGGCGGGCGG
GGCGGACGCCGCGAACCTGCTGAAACCGGCGCTGGCACGCGGTGAACTGCGTACCATCGCTGCCACTACC
TGGTCCGAATACAAGCAGTATTTCGAGCGCGATGCTGCCCTGGAGCGCCGTTTCCAGATGGTGAAAGTGG
ACGAGCCGGACGACGACACCGCCTGCCTGATGCTGCGTGGCCTGAAATCCCGCTATGCGGAGCACCACAA
CGTGCACATCACCGACGGAGCCGTGCGCGCCGCCGTCACGCTTTCCCGCCGCTACCTGACGGGCCGCCAG
CTGCCGGACAAAGCCGTTGACCTGCTCGATACCGCCAGCGCCCGAGTGCGTATGAGCCTTGATACTGTGC
CGGAACCATTAACCCGCATCCGCGCGCAGATAACCGCCCTGGAAATGGAAAAGCAGGCATTGCTGGAAGA
TATCGCCGTGGGTAATCAGAACCATGATGAACGCCTGGCGGCCATTGAGCAGGAGGAGAACAGCCTTATT
GTTGAGCTGGACGTGCTGGAAACCCGGTATGGCGAAGCACTGAAATTCACCGGCCAACTGCTGGAAAGCC
GCCAGGATATCTCCCGCCAGGGGGAGACCCGTCAACTGCAGCAGGCGCTGAACAGCATGCAGCTGCTGCC
GGTGGATGTGGATGCGCGCACTGTAGCTACAGTTATTGCCGACTGGACCGGTGTGCCGCTCTCCTCGCTG
ATGAAAGACGAGCAGACCGAACTGCTGACGCTGGAAAATGAAATCGGCAAGCGCGTGGTCGGGCAGGATG
TGGCGCTTGTTGCTATTGCTCAGCGCCTGCGGGCGGCAAAAACCGGCCTCACGTCAGAAAATGGCCCGCA
GGGGGTATTCCTGCTGGTGGGGCCGAGCGGTGTGGGGAAAACCGAAACCGCGCTGGCGCTGGCGGACGTG
ATGTACGGCGGCGAAAAATCGCTTATTACCATCAACCTGTCGGAGTACCAGGAGCCGCACACGGTTTCCC
AACTGAAAGGATCGCCGCCGGGCTACGTAGGTTACGGCCAGGGGGGGATCCTCACCGAAGCGGTGCGCAA
ACGCCCCTACAGCGTGGTGCTGCTGGATGAGGTGGAAAAAGCGCACCGCGACGTGATGAACCTCTTCTAT
CAGGTGTTCGATCGCGGCTTTATGCGCGACGGGGAAGGGCGTGAAATCGACTTCCGTAACACCGTAATTA
TGATGACCTCGAACCTTGGCAGCGACCACCTGATGCAGCTGCTTGATGAGCAACCGGACGCCAGCGAAGG
CGATCTGCACGAGCTGCTGCGCCCGATTCTGCGTGATCACTTCCAGCCGGCACTGCTGGCGCGCTTCCAG
ACGGTGATTTACCGCCCGCTGGCCGAAGCGGCCATGCGTACCATCGTGGAAATGAAGCTGTCACAGGTCA
GCAAGCGCCTGTATCGACACTACGGTCTGACTACGCATATCGACAGGGGGCTGTATGACGCCCTGACGGC
TGCCTGCCTGCTGCCGGATACCGGTGCGCGTAACGTCGACAGTCTGCTCAGCCAGCAAATCCTCCCCGTG
CTGAGCCAGCAGCTTTTAACGTATATGGCCGCGAAACAAAAACCACACTCCCTGACGCTCGGCTGGAATG
ATGAAGAGGGGATTGGGCTGGAATTTGATGCCACGGATACCACAGGAGAGGCGTAA