SecReT6
Protein ID: 387888472
SecReT6 ID655
T6SS typei2
Gene symbol-
Locus tagEBL_c11550
StrainEscherichia blattae DSM 4481
Repliconchromosome [GenBank: NC_017910] [Browse all T6SS(s) in this replicon]
Location [Strand]1188798..1191152 [+]
ProductVGR-related protein
NoteTssI
UniProt IDI2B6V5
KEGG IDebt:EBL_c11550
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-57, Aligned region: 42..350
Phage_GPD [PF05954], Evalue: 1.20E-57, Aligned region: 574..608
DUF2345 [PF10106], Evalue: 4.10E-34, Aligned region: 573..594
DUF2345 [PF10106], Evalue: 4.10E-34, Aligned region: 609..750
T6SS_Vgr [PF13296], Evalue: 1.60E-30, Aligned region: 486..589
T6SS_Vgr [PF13296], Evalue: 1.60E-30, Aligned region: 642..654
Phage_base_V [PF04717], Evalue: 6.10E-16, Aligned region: 20..37
Phage_base_V [PF04717], Evalue: 6.10E-16, Aligned region: 90..119
Phage_base_V [PF04717], Evalue: 6.10E-16, Aligned region: 341..352
Phage_base_V [PF04717], Evalue: 6.10E-16, Aligned region: 402..481
Protein Sequence: 784 a.a.     [Download]
>gi|387888472|ref|YP_006318770.1| VGR-related protein [Shimwellia blattae DSM 4481 = NBRC 105725]
MMESITSLAQKKIDEALGLSRYRVDVHECPHFLDVLRFRASERLSQPWCYDVTFTCAASIASNEVMLKPA
SFTFQAPLFDGTPAAPVRTVYGVVDTFRRISVSGDEITYALRLVPRIALMQHTERCAVYLNQSVPEVVEQ
ILCSHGLEGAAFEFRLSQTYPVRELITQWSETDLAFVQRLLAEVGIFWRFEMDSRIEQDVVIFQDSQMQY
QFGVKLPIIPPSRASDSGQESTWDIRPTDRVVTGSVATRDYNYRDALAPQDSSVTVRQEGGATIGEVYHY
AEPFLSQGDAATPESGAWYARLRHERYLNAQQTVTGRASSPVLAPGEVLEPQGRGLPESLKDGIVITGIY
TSGARDKGFQLRFTGIPYSETVCYRPGLLNRPVMAGSLPARVESDEKHDTYAYLDNQGRYRVRLDFDRNS
TEQGYAYLWLRMAKPYAGDTYGFHSPLLDGTEVSVMFDGGDPDRPYIADARHDSEHPDHVTRDNHTRNIW
RTAGDNKFRLEDKRQEEHFKLATPFGKTQLNGGHIVDSEREPRGTGFELRTDEFGVLRAGRGMFLTADAQ
PAAQGKTLDMAPATERLHQSAAEMKRLNLLAQQAQALTCDLESQNRLLEKRLRDLQSAALLGSAPQGIAF
TSGEHLQMTGRQNTILNAGQHLDMGAMKNITLAASESVGLFAHQAGAKLIANQGDVEVRAEASSMEMTSA
LLFTISSNKDELLISAPKLRLNGGGSSITLDKGGILEETQGDYLVRSAHYRSPMAGGSMDITPPQFSQTS
ASVTPSRTRHIPSR
 
Nucleotide Sequence: 2355 bp     [Download]
>gi|387887350|ref|NC_017910.1|:1188798-1191152 Escherichia blattae DSM 4481 chromosome, complete genome
ATGATGGAGAGTATTACCAGTCTGGCACAGAAGAAAATCGATGAAGCGCTGGGGCTGTCCCGTTATCGTG
TGGATGTCCATGAATGCCCGCATTTTCTCGACGTCCTGCGCTTTCGTGCCAGTGAAAGGCTGAGCCAGCC
GTGGTGCTACGATGTCACCTTCACCTGTGCGGCGAGCATCGCCAGCAATGAGGTAATGCTGAAGCCGGCC
TCTTTCACCTTCCAGGCACCATTGTTTGATGGTACGCCAGCTGCGCCGGTGCGCACGGTGTATGGCGTGG
TGGATACATTCCGTCGGATCTCTGTGTCGGGGGATGAAATCACCTATGCCCTGCGACTCGTGCCGCGTAT
CGCCCTGATGCAGCACACCGAGCGCTGCGCGGTATATCTCAATCAGTCCGTGCCGGAAGTGGTAGAGCAG
ATACTGTGCTCCCACGGGCTGGAAGGGGCGGCTTTTGAATTTCGTCTGTCGCAGACCTACCCGGTCCGCG
AGCTCATTACCCAGTGGAGTGAGACAGATCTGGCCTTTGTTCAGCGCCTGCTGGCTGAGGTGGGCATCTT
CTGGCGCTTTGAAATGGACAGCCGCATTGAACAGGATGTGGTGATTTTTCAGGATAGCCAGATGCAGTAT
CAGTTCGGCGTGAAGCTGCCCATTATTCCGCCGTCACGCGCCAGCGATAGCGGCCAGGAGAGCACCTGGG
ATATTCGGCCAACAGACCGTGTGGTCACCGGTAGTGTGGCTACCCGCGATTATAACTATCGCGATGCGCT
GGCCCCACAGGACAGTTCAGTGACGGTTCGCCAGGAGGGTGGGGCCACCATCGGTGAGGTGTATCACTAC
GCTGAGCCGTTCCTGAGCCAGGGGGATGCGGCAACTCCGGAGAGCGGTGCCTGGTATGCCCGCCTGCGTC
ATGAGCGCTACCTCAATGCTCAGCAGACCGTCACGGGGCGTGCGAGTAGCCCGGTTCTGGCCCCGGGTGA
AGTGCTGGAGCCACAGGGCCGCGGACTGCCTGAGTCGCTGAAGGACGGCATCGTCATCACTGGTATTTAC
ACTTCAGGCGCACGCGATAAGGGCTTCCAGTTGCGGTTCACGGGTATTCCTTACAGCGAAACGGTCTGCT
ACCGCCCTGGGTTGCTGAACCGCCCGGTGATGGCTGGCTCCCTGCCTGCCCGGGTGGAGAGCGATGAGAA
GCATGACACTTATGCTTATCTCGACAACCAGGGGCGCTATCGCGTCCGGCTCGATTTTGACCGCAACAGC
ACTGAGCAGGGATATGCCTACCTCTGGCTGCGTATGGCAAAACCTTATGCCGGAGATACTTACGGTTTCC
ACTCCCCGCTGCTTGATGGCACCGAAGTCTCGGTGATGTTTGATGGCGGTGATCCTGACCGGCCATACAT
TGCCGACGCCCGGCACGATTCTGAACACCCTGACCACGTCACGCGTGATAACCATACGCGTAATATCTGG
CGCACGGCCGGGGACAACAAATTCCGCCTGGAAGACAAGCGTCAGGAAGAGCATTTCAAGCTCGCGACAC
CTTTTGGCAAGACGCAACTCAACGGCGGCCACATCGTGGACAGTGAGCGTGAGCCACGCGGTACCGGATT
TGAACTGCGTACCGATGAGTTCGGGGTGCTGCGCGCCGGACGGGGGATGTTCCTGACCGCCGATGCGCAG
CCTGCGGCGCAGGGCAAAACGCTGGACATGGCGCCGGCGACTGAGCGCCTGCATCAGTCAGCGGCCGAAA
TGAAGCGGCTCAATCTGCTCGCGCAGCAGGCTCAGGCACTCACGTGCGACCTTGAAAGCCAGAACCGGCT
GCTGGAAAAACGCCTGAGAGATCTTCAGTCTGCCGCCCTGCTGGGCAGTGCACCGCAGGGTATTGCGTTC
ACTTCGGGGGAGCACCTTCAGATGACCGGCAGGCAGAACACTATTCTGAATGCGGGTCAGCATCTGGATA
TGGGGGCAATGAAGAACATCACGCTGGCTGCCAGTGAGTCTGTCGGGCTGTTTGCCCACCAGGCCGGGGC
AAAGCTGATTGCTAATCAGGGAGATGTTGAGGTCCGTGCAGAGGCGAGCTCAATGGAGATGACATCGGCG
CTGCTGTTTACCATCAGCAGTAACAAGGATGAGCTGCTGATCAGTGCGCCTAAACTGCGGCTCAACGGCG
GTGGATCCAGTATCACGCTGGATAAGGGCGGCATTCTGGAAGAAACCCAGGGTGATTACCTGGTCAGGTC
TGCACATTACCGCTCACCGATGGCCGGTGGCAGCATGGATATCACGCCGCCGCAGTTCAGCCAGACGAGC
GCCAGCGTGACGCCCTCCAGAACACGCCATATCCCTTCACGTTAA