SecReT6
Protein ID: 387888498
SecReT6 ID655
T6SS typei2
Gene symbol-
Locus tagEBL_c11810
StrainEscherichia blattae DSM 4481
Repliconchromosome [GenBank: NC_017910] [Browse all T6SS(s) in this replicon]
Location [Strand]1218535..1220154 [+]
ProductImpA-related protein
NoteTssA
UniProt IDI2B6Y1
KEGG IDebt:EBL_c11810
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.90E-15, Aligned region: 71..129
Protein Sequence: 539 a.a.     [Download]
>gi|387888498|ref|YP_006318796.1| ImpA-related protein [Shimwellia blattae DSM 4481 = NBRC 105725]
MVTAETLLTLCLPDAARRTALIAQARENLSRWSPWLTPLPGGHGAGNDPTYEDDFQLMREEINKFSGTDT
GVLCRLAESILTRSARDIRVVTWYILARLLRDGDAGLADGILLLTAMLSQAGGHCHPQRSAARLAALDWL
NSEKMLDAFSRWPDVTREDTARTAAALCLLESALGSLPEVERPAFTALLRTLETRLAGSGGLDTPVASSG
QDNPGESPHSTPTPGAAVPEAAVVKSEVELVRQLRVLSGWVVEQPQGWLAAHRMMKAARWDLVTQLPALD
ASGRTRLLPPKADYRAQLKRLYLQQSWTELVEQVDVMFTEGGNRFWLDLQWYLWQGLSRAGGTWEHWAEY
ILSDLRLLLKRLPGLETLAWNDGTPLADEVTLNWIAEKVNNEMSGFAGEPAVLSGGQTDDIFALEAEAME
KGDNDGPEAALAWLQNRPDMASPRSRWLLRLLMARVAEQYGRNELALHLLGELTGSAPQLTLSEWEPGLL
FDVQASRLRLLRLKAGRSESDKARFAPEMDSLLATLIALDPARAMVLCV
 
Nucleotide Sequence: 1620 bp     [Download]
>gi|387887350|ref|NC_017910.1|:1218535-1220154 Escherichia blattae DSM 4481 chromosome, complete genome
ATGGTGACTGCAGAAACACTCCTGACCCTGTGTCTTCCGGATGCAGCCCGGCGTACCGCACTGATCGCAC
AGGCCCGGGAAAACCTCTCCCGGTGGTCGCCGTGGCTGACACCACTCCCGGGCGGTCATGGGGCCGGAAA
CGACCCGACCTATGAAGATGATTTCCAGCTGATGCGTGAGGAAATCAATAAGTTTTCCGGCACCGATACC
GGGGTGCTGTGCCGCCTGGCGGAAAGCATTCTTACCCGCAGTGCGCGGGATATCCGGGTGGTGACCTGGT
ATATCCTGGCACGCCTGCTGCGTGATGGTGATGCGGGTCTGGCTGACGGTATCCTGCTGCTGACGGCAAT
GCTCAGCCAGGCCGGGGGGCACTGTCATCCGCAGCGCAGCGCCGCAAGGCTGGCTGCACTCGACTGGCTG
AACAGTGAAAAAATGCTGGATGCATTCTCGCGATGGCCGGACGTGACGCGGGAAGATACCGCCAGAACGG
CCGCAGCGCTGTGTCTGCTGGAGTCCGCGCTGGGATCTTTACCGGAGGTTGAGCGCCCTGCGTTTACCGC
CCTGCTGCGGACCCTGGAAACCCGCCTTGCCGGTAGCGGTGGGCTGGATACGCCGGTGGCTTCATCAGGC
CAGGATAATCCAGGTGAAAGCCCCCACAGCACACCGACACCGGGCGCTGCAGTGCCGGAGGCTGCTGTCG
TCAAATCAGAAGTAGAGCTGGTACGCCAGCTGCGCGTGTTGTCCGGCTGGGTGGTAGAGCAGCCGCAGGG
CTGGCTTGCCGCTCACCGGATGATGAAGGCCGCCCGCTGGGATCTGGTAACGCAACTGCCGGCGCTGGAT
GCGAGCGGCAGGACGCGTCTGCTGCCGCCGAAGGCCGACTACCGGGCTCAGCTGAAACGCCTGTACCTGC
AGCAGAGCTGGACCGAACTGGTGGAGCAGGTGGATGTGATGTTCACTGAAGGTGGCAACCGCTTCTGGCT
CGATTTGCAGTGGTATCTGTGGCAGGGGCTGAGCCGGGCTGGTGGGACGTGGGAACACTGGGCGGAGTAC
ATACTCAGCGATCTGAGACTGTTGCTGAAACGCCTGCCAGGCCTGGAGACGCTTGCCTGGAACGATGGCA
CGCCCCTGGCCGATGAGGTGACGCTGAACTGGATAGCCGAAAAGGTCAACAATGAAATGTCCGGGTTTGC
TGGTGAGCCTGCGGTGCTAAGCGGAGGCCAGACGGATGACATATTTGCGCTGGAAGCCGAGGCGATGGAA
AAAGGTGACAACGATGGCCCGGAGGCCGCGCTGGCCTGGCTTCAGAATCGCCCGGATATGGCCTCACCCC
GAAGCCGCTGGTTACTCCGTTTACTCATGGCCCGGGTGGCAGAGCAGTACGGGCGCAATGAGCTCGCACT
GCACCTGCTCGGTGAACTTACCGGGAGCGCCCCACAGCTGACCCTCAGTGAGTGGGAGCCAGGGCTGCTG
TTTGATGTGCAGGCCAGCCGTCTCCGGCTGTTGCGCCTGAAAGCCGGGCGCAGCGAGAGCGACAAAGCCC
GTTTTGCGCCTGAAATGGACAGCCTGCTGGCCACGCTGATTGCCCTCGACCCGGCACGTGCGATGGTGCT
GTGTGTGTAG