SecReT6
Protein ID: 387888499
SecReT6 ID655
T6SS typei2
Gene symbol-
Locus tagEBL_c11820
StrainEscherichia blattae DSM 4481
Repliconchromosome [GenBank: NC_017910] [Browse all T6SS(s) in this replicon]
Location [Strand]1220231..1222000 [+]
Producthypothetical protein
NoteTssF
UniProt IDI2B6Y2
KEGG IDebt:EBL_c11820
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 5.20E-185, Aligned region: 6..586
Protein Sequence: 589 a.a.     [Download]
>gi|387888499|ref|YP_006318797.1| hypothetical protein EBL_c11820 [Shimwellia blattae DSM 4481 = NBRC 105725]
MDDLTLRYYEAEMRYLREAGKEFARAHPDRAAMLNLDKTGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYMRTIPSLSVVAFTPDWRQLRKMEVLENGFSVLSRPVGPDNTVCQYRTTRDVPLQPLH
LSEARLQTEPDGRAAIRLRFECPDKVDWAKAGIDKVAIYLDADSPVASALHLALTRRVQAMYIRHSETRT
GRVRFEGWCKPMGFDDTDRLWPKGDSAFSGYQLLLEYFSFREKFMFVELKGLELAGLSQKTTWFETDIVL
DGGWPSDMPFETDNFRLHCAPVINLFSLEADPLTPDPLQNEYLLRPMRVQDGHTEIYSVDTIHGAVKNGK
HPYVPFTSFRHRGGMMRHDAPERYFHTRVKRGPSGLYDTWLILGGKSFEMEQLSQAPESLSIRITGTNGQ
LPRRSLESTLLDRVVKAGKVPVRVLNLTVPTLPIYPPANDRFHWRVMSHLGSSFLSMMDNPEVLRGTLAL
YDWTDDEMNRRRLEAIVAVKHTLIRRFEQGFMLRGVDIEITLNADNFAGEGDVALFGEMLHRFFALYADV
HLFNQLTLVLQPTGKRLRWKENHSQHIPG
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|387887350|ref|NC_017910.1|:1220231-1222000 Escherichia blattae DSM 4481 chromosome, complete genome
ATGGATGATTTAACCCTGCGCTACTATGAAGCCGAAATGCGCTATCTGCGCGAAGCTGGTAAAGAGTTTG
CTCGCGCTCACCCCGACCGCGCGGCCATGCTTAACCTGGATAAAACCGGGGCCCGTGACCCGTATGTGGA
GCGTCTGTTCGAGGGCTTCGCCTTTCTGATGGGCCGCCTGCGTGAAAAGCTCGATGATGACCTGCCGGAG
CTGACCGAAGGGCTGGTGAGCCTGCTCTGGCCGCATTACATGCGCACCATCCCGTCGCTGTCGGTAGTGG
CGTTCACGCCGGACTGGCGTCAGCTTCGCAAAATGGAAGTACTCGAAAACGGCTTTTCCGTCCTGTCGCG
CCCGGTCGGCCCCGATAACACGGTCTGCCAGTATCGCACCACCCGTGACGTACCGCTGCAGCCGCTGCAT
CTGAGTGAGGCCCGCCTGCAAACTGAGCCCGATGGCCGGGCCGCTATTCGTCTGCGTTTCGAATGCCCGG
ATAAAGTGGACTGGGCGAAAGCCGGGATTGATAAGGTGGCTATTTACCTTGATGCTGACAGCCCGGTGGC
TTCGGCCCTGCATCTGGCGCTGACACGTCGGGTGCAGGCGATGTATATCCGCCACAGTGAGACCCGCACC
GGGCGGGTCCGCTTTGAGGGCTGGTGTAAACCCATGGGCTTTGATGACACTGACCGGCTGTGGCCGAAAG
GGGATTCAGCGTTCAGTGGCTACCAGCTGTTGCTGGAGTATTTCAGCTTCCGCGAGAAGTTTATGTTTGT
GGAGCTTAAAGGGCTGGAGCTTGCTGGCCTGAGCCAGAAAACCACCTGGTTTGAGACCGATATCGTGCTC
GACGGCGGCTGGCCATCAGATATGCCGTTTGAGACCGATAATTTCCGCCTGCACTGTGCGCCGGTGATTA
ACCTGTTCTCACTGGAAGCGGATCCGCTGACGCCCGATCCGCTGCAGAACGAATACCTGCTGCGCCCGAT
GCGCGTGCAGGACGGGCATACGGAAATCTACAGTGTGGACACTATCCACGGTGCGGTGAAGAATGGCAAA
CACCCGTACGTACCATTCACCAGTTTCCGCCACCGTGGTGGCATGATGCGCCATGACGCGCCGGAGCGTT
ATTTCCATACCCGTGTTAAGCGCGGACCTTCGGGCCTTTATGACACATGGCTTATCCTGGGCGGCAAGTC
ATTCGAGATGGAGCAGTTGTCTCAGGCCCCGGAGTCGCTCTCTATCCGCATCACCGGCACCAACGGCCAG
CTGCCGCGCCGCTCACTGGAAAGTACGCTACTTGACCGGGTGGTGAAGGCGGGAAAGGTGCCGGTCAGGG
TCCTGAACCTGACGGTGCCGACGCTGCCGATTTACCCGCCAGCAAACGACCGCTTCCACTGGCGGGTGAT
GAGCCACCTGGGCTCCAGTTTCTTAAGCATGATGGATAACCCGGAAGTGCTGCGCGGCACCCTGGCACTG
TACGACTGGACGGATGACGAGATGAACCGCCGTCGTCTGGAGGCGATTGTGGCGGTGAAACACACCCTGA
TCCGCCGCTTTGAGCAGGGCTTTATGCTGCGCGGGGTTGATATCGAAATCACCCTTAACGCGGACAATTT
TGCCGGAGAAGGCGATGTCGCTCTGTTTGGCGAAATGCTGCACCGCTTCTTTGCCCTCTATGCCGATGTC
CACCTCTTTAACCAGCTCACACTGGTGCTGCAACCGACAGGGAAACGACTGCGATGGAAAGAGAATCACA
GCCAGCACATTCCGGGCTGA