SecReT6
Protein ID: 387888500
SecReT6 ID655
T6SS typei2
Gene symbol-
Locus tagEBL_c11830
StrainEscherichia blattae DSM 4481
Repliconchromosome [GenBank: NC_017910] [Browse all T6SS(s) in this replicon]
Location [Strand]1221964..1223043 [+]
Producthypothetical protein
NoteTssG
UniProt IDI2B6Y3
KEGG IDebt:EBL_c11830
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.60E-81, Aligned region: 19..321
Protein Sequence: 359 a.a.     [Download]
>gi|387888500|ref|YP_006318798.1| hypothetical protein EBL_c11830 [Shimwellia blattae DSM 4481 = NBRC 105725]
MERESQPAHSGLTKRLSGHIWRINFYRFCQLLEQEKPDAPKLGSTEKLAADPVRFRPWPGMGFPVSELKA
VETDEDHTDLSPTVRTTFLGMYGVDSPLPTACLDDIAQRREGHEATTAFLDIFSHRIHTQYYRIWRKYAY
PATFEAGGVDDTSQCLLGLVGLGIPGTAEQVATPVSRFLALLGTMRLPTRNAEGIRQLVSLLAPDTRATV
ISPDPVKVPVENRSGLGKGHRVSLSQRATLGRTGKEACSRILLMLATDNPQEAQGWLPGAQLHTDLMVLL
RVYMGYRSDVRLRLTVPVSCLPEPRLGKTSQVQLGRTGVLGLKRGRPATCTHLTVSLGTCEGLSCETLRP
AQPGGYRFD
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|387887350|ref|NC_017910.1|:1221964-1223043 Escherichia blattae DSM 4481 chromosome, complete genome
ATGGAAAGAGAATCACAGCCAGCACATTCCGGGCTGACGAAGCGGCTGAGCGGCCACATCTGGCGGATTA
ATTTTTACCGCTTCTGCCAGCTTCTGGAGCAGGAAAAACCGGATGCGCCGAAGCTCGGCAGCACCGAAAA
ACTCGCTGCCGACCCGGTGCGTTTTCGCCCGTGGCCGGGCATGGGGTTCCCGGTCAGTGAACTGAAGGCG
GTCGAAACCGATGAGGACCACACGGACCTGTCGCCGACGGTGCGCACCACTTTTCTCGGGATGTATGGCG
TGGATTCGCCACTGCCGACCGCCTGTCTCGACGATATTGCGCAGCGCCGGGAAGGGCATGAAGCCACCAC
CGCGTTCCTTGATATCTTCAGCCACCGTATCCACACCCAGTATTACCGTATCTGGCGCAAATACGCTTAC
CCGGCAACCTTCGAGGCAGGCGGTGTGGATGACACGTCTCAGTGCCTGCTGGGGCTGGTTGGCCTTGGTA
TTCCGGGTACGGCAGAGCAGGTGGCTACACCGGTTTCCCGCTTCCTGGCGCTACTGGGCACCATGCGGCT
GCCAACCCGAAACGCCGAAGGCATCCGCCAGCTGGTGAGCCTGCTGGCCCCGGATACCCGGGCCACGGTT
ATCAGCCCGGATCCGGTGAAAGTTCCTGTAGAGAATCGCAGCGGGCTCGGTAAAGGACACCGGGTTTCCC
TGTCACAGCGCGCCACGCTCGGCAGAACCGGGAAAGAAGCCTGCAGCCGTATCCTGCTGATGCTGGCAAC
CGACAACCCACAAGAGGCACAGGGCTGGCTGCCCGGCGCTCAGCTGCACACTGACCTGATGGTACTGCTG
CGGGTGTACATGGGTTACCGCTCTGATGTACGCCTTCGCCTCACTGTACCGGTAAGCTGCCTGCCTGAAC
CGCGTCTGGGTAAGACAAGCCAGGTACAACTGGGGCGCACCGGTGTACTGGGCCTGAAGCGGGGCCGCCC
TGCGACCTGCACGCACCTGACCGTAAGCCTTGGCACCTGTGAAGGCCTGTCCTGCGAGACTCTGCGGCCG
GCACAACCCGGTGGCTACCGTTTCGACTGA