SecReT6
Protein ID: 387888502
SecReT6 ID655
T6SS typei2
Gene symbol-
Locus tagEBL_c11850
StrainEscherichia blattae DSM 4481
Repliconchromosome [GenBank: NC_017910] [Browse all T6SS(s) in this replicon]
Location [Strand]1223638..1226202 [+]
ProductVGR-related protein
NoteTssI
UniProt IDI2B6Y5
KEGG IDebt:EBL_c11850
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.50E-53, Aligned region: 37..343
DUF2345 [PF10106], Evalue: 2.00E-31, Aligned region: 607..745
T6SS_Vgr [PF13296], Evalue: 4.90E-26, Aligned region: 475..577
Phage_base_V [PF04717], Evalue: 1.30E-13, Aligned region: 395..470
Protein Sequence: 854 a.a.     [Download]
>gi|387888502|ref|YP_006318800.1| VGR-related protein [Shimwellia blattae DSM 4481 = NBRC 105725]
MDTTLDNWLALFDGQTRYRLEINDSPLKPDVLNFRGREALNAPFEWWIEFTTPQKGISRRDAMLKYATLS
MHSGRVVQGIITGFEVLRETVDQTHFAVTLSSRLALLAHTRRCAVYQNVSVPELVEQILRSHGLEGADFE
FRLERAYPVRELITQWQETDLQFIQRILAEDGIWFCTGVNTTTGLDTVTLADSQLCYQFDVRLPYREPSA
LYDGAVEAVWDARVWHHTVTGSVTTRDYNYRTAGTPMDATASVRNEAATTGERYRYAAPYREAGDDTTPE
PETESGAFYARIQHEHALNNAIRLHLFSNASHLTPGMVLETGDSEVPELKEGMVITLATFRAARDTRLHV
SVWGMPYSEQFCFRPEPIPRPLIAGTLAARIESDEKNAPYAHLDETGRYRVKLDFSREDAAQGYNYLWIR
QAKPYAGEIYGWHTPLTDGTEVGIAFDGGDPDRPYIARAFHDSEHPDVVTRDNRSQNILRTAGQNELRME
DQRKSEHIALSTPFGATALNQGHIVNRENGVRGTGFELRTDEFGVIRVAKGLFITADGKVHGEGHVLDMD
VALREIEAIRAQIGELAIATRKAKALEADIASQQAMFTTRLKTLNEVLHFSAPGGMAFTSAEHLQLAAAD
NLALNAGGDISIGAEGHITGLAGDSVGMFAQHGKLSLISAQGPVQFQAQNGVMHLSAEQKLTLISAKEML
LAGKKRIRLVGGGSSILIEQGQIKYETAGTYTRKASRLDTEGGASQTPDVPWLADPLKDRNDALMQYLYH
DDAPVVGAPFTATLADGSVRTGNLDGAGYLHLDDVPDGPMAVELGPDARNYLRKNNSDNQQFVGSSVTES
DIDVLITKHSGGVE
 
Nucleotide Sequence: 2565 bp     [Download]
>gi|387887350|ref|NC_017910.1|:1223638-1226202 Escherichia blattae DSM 4481 chromosome, complete genome
ATGGATACAACTCTGGATAACTGGCTGGCGCTGTTTGACGGGCAAACCCGCTATCGTCTTGAGATTAACG
ACAGCCCCCTGAAGCCGGATGTGCTGAACTTCCGCGGGCGCGAAGCGCTGAATGCGCCGTTCGAATGGTG
GATTGAGTTCACCACACCACAGAAAGGCATCAGCCGCCGGGATGCGATGCTGAAGTATGCCACGCTCAGT
ATGCACTCAGGCCGGGTGGTACAGGGTATCATCACTGGTTTTGAGGTCCTCCGGGAGACTGTGGACCAGA
CACATTTTGCCGTAACGCTCTCCTCGCGCCTGGCGCTGCTTGCCCACACCCGCCGCTGTGCGGTGTACCA
GAATGTCTCCGTCCCGGAACTGGTGGAGCAGATCCTGCGCAGCCACGGGCTGGAGGGGGCGGATTTTGAA
TTCCGGCTGGAGCGGGCTTACCCGGTTCGCGAACTGATCACCCAGTGGCAGGAAACTGACCTGCAGTTTA
TTCAGCGCATTCTCGCAGAAGACGGTATCTGGTTCTGTACAGGCGTCAACACCACCACCGGGCTCGATAC
GGTGACCCTGGCAGACAGCCAGCTGTGTTATCAGTTTGATGTGCGCCTGCCATATCGTGAGCCCTCCGCA
CTGTATGATGGTGCGGTCGAAGCAGTGTGGGATGCCAGAGTGTGGCACCACACGGTGACCGGCAGTGTGA
CCACCCGGGATTACAACTACCGCACCGCCGGTACGCCAATGGATGCGACCGCAAGCGTCAGAAACGAGGC
GGCCACCACCGGCGAACGCTACCGCTATGCGGCCCCGTACCGCGAGGCGGGCGATGACACCACCCCTGAG
CCGGAAACCGAAAGCGGTGCCTTTTACGCCCGTATTCAGCATGAACATGCCCTCAATAATGCCATCCGCC
TGCATCTGTTCAGTAACGCCAGCCACCTGACACCGGGCATGGTGCTGGAAACCGGCGACAGTGAAGTGCC
GGAGCTGAAAGAGGGAATGGTGATTACGCTCGCCACTTTCCGCGCGGCCCGTGACACGCGTTTGCATGTC
TCCGTCTGGGGTATGCCTTACAGCGAGCAGTTCTGCTTCAGGCCAGAGCCAATACCACGTCCGCTTATCG
CCGGTACGCTGGCCGCCCGCATAGAGAGCGATGAGAAGAATGCGCCGTATGCGCATCTCGATGAAACAGG
GCGCTACCGGGTGAAGCTGGATTTCAGCCGTGAGGACGCTGCGCAGGGCTATAACTACCTGTGGATACGC
CAGGCGAAGCCATATGCCGGGGAAATATACGGCTGGCACACGCCGCTGACTGACGGCACCGAAGTGGGCA
TTGCCTTTGACGGTGGAGACCCGGACCGGCCGTATATCGCCCGTGCATTTCATGACTCTGAGCATCCGGA
TGTGGTCACCCGCGACAACCGTAGCCAGAACATCCTGCGCACTGCGGGCCAGAACGAACTGCGCATGGAA
GACCAGCGCAAGAGTGAGCATATTGCCCTCAGTACTCCGTTCGGGGCCACGGCGCTGAATCAGGGCCACA
TCGTCAACAGGGAGAACGGGGTGCGCGGTACCGGGTTTGAGCTGCGCACCGATGAGTTCGGGGTTATTCG
TGTGGCTAAAGGGCTGTTTATCACCGCCGACGGAAAAGTGCACGGCGAAGGCCATGTGCTGGATATGGAT
GTGGCACTTCGTGAGATAGAAGCCATACGCGCTCAAATCGGGGAGCTGGCCATCGCTACCCGGAAGGCGA
AAGCCCTGGAGGCCGATATCGCCAGCCAGCAGGCGATGTTTACCACACGCCTGAAGACCCTCAATGAGGT
GCTGCACTTCTCTGCCCCCGGGGGGATGGCGTTTACCAGCGCTGAGCATCTGCAACTGGCGGCCGCTGAC
AATCTCGCCCTGAATGCGGGCGGGGATATCAGCATTGGCGCTGAGGGACATATCACCGGCCTGGCCGGAG
ACAGCGTGGGGATGTTTGCCCAACACGGCAAGCTGAGCCTGATTTCGGCACAGGGGCCGGTCCAGTTTCA
GGCGCAGAACGGGGTGATGCACCTGAGTGCGGAGCAGAAACTGACCCTCATCTCAGCAAAAGAGATGCTG
CTGGCCGGGAAGAAGCGCATACGCCTGGTGGGGGGCGGAAGCTCCATCCTCATTGAGCAGGGGCAAATCA
AATACGAGACGGCGGGGACGTATACCCGCAAGGCCAGCCGGCTGGACACGGAAGGTGGGGCTTCGCAGAC
TCCGGATGTGCCGTGGCTCGCAGACCCGCTGAAAGACCGCAATGATGCACTGATGCAGTACCTCTATCAT
GATGACGCACCGGTGGTTGGTGCGCCGTTTACCGCGACACTGGCAGACGGCTCTGTGCGTACCGGGAACC
TTGATGGGGCAGGCTACCTGCATCTTGATGATGTGCCCGATGGCCCGATGGCGGTGGAGTTGGGGCCGGA
TGCACGGAATTATTTACGAAAAAATAATTCCGATAATCAGCAATTTGTTGGTTCGTCGGTGACTGAATCC
GATATTGACGTACTGATAACGAAACATAGCGGAGGTGTTGAATGA