SecReT6
Protein ID: 387893593
SecReT6 ID656
T6SS typei1
Gene symboltssA2
Locus tagPflA506_2407
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]2622259..2623815 [+]
Producttype VI secretion protein TssA2
NoteTssA
UniProt IDI2BPP2
KEGG IDpfc:PflA506_2407
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.50E-22, Aligned region: 59..118
Protein Sequence: 518 a.a.     [Download]
>gi|387893593|ref|YP_006323890.1| type VI secretion protein TssA2 [Pseudomonas fluorescens A506]
MQPKIVYSEQLYAYCQELARTACSPSSFVGGDMRFSSEFEVLETELGKAHSIHGAGLPDWQKISEISECI
LREHSKDLRVAAWLTWALYQRDSFAGLLAGLGVLRELCEHHWTQVYPVKLRTRVAAFGWLVLRLEQACAH
NLPLSDQRPLFQALLEHLECLDQIWGEQLGSEAPLLLPVRRQLSARLAQAAAEPGDVAGVIARVKPAPSP
LPAPEQPLNNEKDAHKRLRALQEQARPLCTWWLRQDAADPRALRLGRTLAWLMLVNYPDANNERVTALRP
LATDKRKRYQDRFSQGHYADLLLELEVSLAGAMFWFDGLRMVWECLEALHADLAMTELEMQFALLLHRLP
NLPEYRFEDGTPFADSATGEWIAFHVMRHLHKPEPSNVVVDSAAQPWEAALQAVMPCLRKDGLKAAVSVL
KQGLRAASGDRARFHWHLALARLCVAAGKHDLARIQLEQLDLQLQRTGLESWEPELAMQVGQLLYRCYDL
LPQNQAVQDGKDTLHRRLCHFDLEAVLE
 
Nucleotide Sequence: 1557 bp     [Download]
>gi|387891255|ref|NC_017911.1|:2622259-2623815 Pseudomonas fluorescens A506 chromosome, complete genome
GTGCAGCCCAAAATAGTTTATTCAGAACAGCTATATGCCTATTGCCAGGAACTTGCCCGGACAGCGTGTT
CGCCAAGCAGTTTTGTTGGTGGCGACATGCGTTTTTCAAGCGAGTTTGAGGTGCTGGAAACCGAGTTGGG
CAAGGCTCATTCCATTCATGGTGCGGGGCTGCCGGATTGGCAGAAGATCAGCGAGATCAGCGAGTGCATT
TTGCGTGAGCATTCCAAGGATCTGCGCGTCGCCGCCTGGTTGACCTGGGCCCTGTATCAGCGTGATTCAT
TCGCTGGGTTGCTGGCTGGTCTCGGTGTGCTGCGCGAACTCTGCGAGCACCATTGGACGCAGGTCTATCC
AGTTAAGCTGCGTACCCGCGTTGCGGCGTTTGGCTGGTTGGTGTTGCGCCTTGAGCAAGCGTGCGCGCAC
AACCTGCCGCTCAGTGATCAACGGCCTTTATTCCAGGCGCTGTTGGAACACCTCGAATGTCTCGATCAGA
TATGGGGTGAACAGCTTGGCAGCGAGGCGCCGCTGCTGTTGCCGGTTCGCCGGCAGCTGTCGGCGCGCTT
GGCCCAGGCTGCTGCCGAACCTGGCGACGTCGCGGGCGTCATTGCCCGGGTCAAACCTGCGCCAAGCCCG
CTGCCGGCCCCCGAGCAACCGCTCAATAACGAAAAAGACGCGCACAAACGGCTGCGCGCATTGCAGGAGC
AGGCTCGGCCTTTATGTACCTGGTGGTTGCGTCAGGATGCGGCCGACCCGCGCGCCTTGCGCCTGGGCCG
AACCTTGGCCTGGCTGATGCTCGTCAATTATCCCGACGCCAATAATGAGCGCGTCACGGCGCTGCGCCCA
TTGGCTACCGACAAGCGCAAGCGCTATCAAGACCGCTTCAGCCAAGGCCATTACGCCGATCTGTTGCTTG
AACTCGAGGTCAGCCTGGCCGGTGCAATGTTCTGGTTCGATGGTTTGCGCATGGTCTGGGAGTGCCTGGA
GGCCTTGCACGCAGACCTCGCCATGACCGAACTGGAAATGCAATTTGCTCTGCTGCTGCATCGCCTGCCG
AACCTGCCTGAGTATCGGTTCGAGGACGGCACGCCCTTTGCCGACTCCGCGACAGGTGAGTGGATCGCAT
TTCACGTCATGCGTCACCTGCACAAGCCTGAGCCCTCCAATGTCGTCGTCGACAGCGCTGCTCAGCCCTG
GGAAGCCGCGTTGCAGGCGGTGATGCCCTGCCTGCGCAAAGACGGGCTCAAGGCCGCGGTGAGTGTGCTC
AAGCAAGGGCTGCGGGCGGCGAGCGGTGATCGAGCGCGTTTTCACTGGCACCTGGCGCTGGCCAGGTTGT
GTGTGGCGGCCGGCAAGCATGACCTGGCCAGGATCCAGCTGGAACAACTCGACCTGCAATTACAGCGCAC
GGGCCTGGAAAGTTGGGAGCCGGAGCTGGCCATGCAAGTGGGCCAACTGCTGTATCGCTGCTACGACCTG
TTGCCACAAAACCAAGCCGTACAAGACGGAAAAGACACCCTGCATCGCCGGTTATGCCATTTCGACCTGG
AAGCAGTACTTGAATAG