SecReT6
Protein ID: 387893594
SecReT6 ID656
T6SS typei1
Gene symboltssB2
Locus tagPflA506_2408
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]2623840..2624337 [+]
Producttype VI secretion protein TssB2
NoteTssB
UniProt IDI2BUP6
KEGG IDpfc:PflA506_2408
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.90E-51, Aligned region: 5..159
Protein Sequence: 165 a.a.     [Download]
>gi|387893594|ref|YP_006323891.1| type VI secretion protein TssB2 [Pseudomonas fluorescens A506]
MAKDGSVAPKERINITFKPAVGSAQEDVELPLKLLVLGDFSQRADPRKLEDRKPIGIDKHTFDEVLAKQA
LSLTLSVPNRLQDAADVEELPVQVRINTMKDFNPANLVEQIPQLQKLMALREALVALKGPLGNTPSFRNA
IERALANGDSRARVLAELGLDRPQA
 
Nucleotide Sequence: 498 bp     [Download]
>gi|387891255|ref|NC_017911.1|:2623840-2624337 Pseudomonas fluorescens A506 chromosome, complete genome
ATGGCCAAAGACGGTTCGGTAGCCCCCAAGGAACGTATCAATATTACCTTCAAACCCGCGGTCGGTAGCG
CTCAGGAAGATGTCGAACTGCCGTTGAAGCTGCTGGTGCTGGGGGATTTTTCCCAGCGCGCGGACCCACG
CAAACTCGAAGATCGCAAGCCCATCGGTATCGACAAGCACACCTTTGACGAGGTGTTGGCCAAGCAAGCA
TTGAGCCTGACGCTGAGCGTTCCCAACCGCCTCCAGGATGCAGCCGACGTGGAAGAACTGCCGGTTCAGG
TGCGAATTAACACCATGAAGGACTTCAACCCCGCGAACCTGGTGGAGCAGATCCCGCAATTGCAAAAGTT
GATGGCATTGCGTGAGGCATTAGTGGCGCTCAAGGGACCGCTGGGCAATACGCCCAGCTTTCGCAACGCT
ATCGAGCGGGCGTTGGCCAATGGTGACTCTCGCGCACGAGTGCTCGCCGAACTGGGCCTGGATAGGCCTC
AAGCCTGA