SecReT6
Protein ID: 387893595
SecReT6 ID656
T6SS typei1
Gene symboltssC2
Locus tagPflA506_2409
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]2624365..2625843 [+]
Producttype VI secretion protein TssC2
NoteTssC
UniProt IDI2BVP7
KEGG IDpfc:PflA506_2409
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.90E-189, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|387893595|ref|YP_006323892.1| type VI secretion protein TssC2 [Pseudomonas fluorescens A506]
MTTIQHGTQPVQVIESGSILDNIISQTLLSADDEAYGIAKRGVSAFIAELVKPHNCDEPVKKRLVDRMIA
EIDTKLSEQMDEILHHPDFQALEASWRGLQLLVDRTNFRENIKIELLNVSREDLLDDFEDSSEITQSGLY
KHVYSAEYGQFGGQPVGAIIANYFLSPSAPDVKLMQYASSVAGMAHAPFIAAAGPSFFGLESFTGLPDLK
DLRDHFEGPQFAKWQSFRQSEDARYIGLTVPRFLLRTPYDPLECPVKTFAYQENVVNSHEHYLWGNTAYA
FATRLTDSFARFRWCPNIIGPQSGGAVEDLPLHHFQSMGEIETKIPTEVLISDRREYELAQEGFIALTMR
KGSDNAAFFSASSVQKPKSFGISEEGKAAELNYRLGTQLPYMMVVNRLAHYLKVLQREQLGAWKERTDLE
LELNKWVRQYVADQENPSAEVRGRRPLRAARIVVSDVEGEPGWYRVNVTVRPHFKYMGADFTLSLVGKLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|387891255|ref|NC_017911.1|:2624365-2625843 Pseudomonas fluorescens A506 chromosome, complete genome
ATGACCACCATTCAACACGGCACGCAACCCGTACAGGTTATCGAAAGCGGTAGCATCCTCGATAACATCA
TTTCCCAGACATTGCTCAGCGCCGACGACGAGGCTTATGGCATCGCCAAGCGCGGCGTGTCGGCGTTTAT
CGCAGAGCTGGTCAAGCCACATAATTGTGACGAACCCGTAAAGAAACGCCTGGTCGACCGGATGATCGCC
GAGATCGACACCAAGCTCAGCGAACAAATGGATGAGATCCTTCACCATCCGGACTTCCAGGCGTTGGAGG
CTTCGTGGCGAGGCTTGCAGTTGCTGGTCGATCGCACCAATTTTCGCGAGAACATCAAGATCGAACTGCT
GAATGTTTCGCGCGAGGACCTGTTGGATGATTTCGAAGATTCATCGGAAATTACCCAGTCCGGGTTATAC
AAGCACGTCTATAGCGCCGAATACGGTCAGTTCGGCGGTCAGCCAGTGGGCGCGATCATTGCCAATTACT
TTCTTTCGCCCAGTGCGCCCGATGTGAAACTGATGCAATACGCATCCAGCGTCGCCGGCATGGCCCACGC
GCCCTTTATCGCTGCAGCGGGGCCAAGTTTCTTCGGCTTGGAAAGCTTCACCGGGTTGCCCGACCTGAAG
GATCTGCGGGACCATTTCGAAGGCCCGCAGTTTGCCAAATGGCAAAGTTTCCGGCAGAGCGAAGACGCAC
GATATATTGGCCTCACCGTGCCGCGCTTTTTGCTGCGCACCCCGTATGACCCCCTTGAGTGCCCGGTCAA
GACCTTCGCCTACCAGGAGAACGTGGTTAACAGCCACGAGCATTACTTGTGGGGCAATACCGCCTATGCC
TTTGCCACTCGCCTGACCGACAGCTTCGCGCGCTTTCGCTGGTGCCCCAACATTATTGGCCCGCAAAGCG
GCGGGGCGGTCGAAGACCTGCCGCTGCATCACTTCCAGAGCATGGGCGAGATTGAAACCAAGATTCCTAC
GGAGGTGCTGATTTCGGACCGACGTGAGTACGAGCTGGCACAAGAAGGTTTCATCGCCTTGACCATGCGC
AAGGGCAGCGATAACGCAGCGTTTTTTTCCGCCAGCTCCGTGCAGAAGCCCAAATCGTTCGGCATCAGTG
AGGAGGGCAAGGCGGCAGAGCTGAATTACCGCTTGGGCACCCAATTGCCCTACATGATGGTGGTCAACCG
CCTGGCTCATTACCTCAAAGTGCTGCAACGGGAGCAGTTGGGCGCGTGGAAAGAGCGGACGGACCTGGAG
TTGGAGCTCAATAAATGGGTTCGCCAATACGTGGCGGACCAGGAAAATCCCAGTGCCGAGGTGCGCGGGC
GGCGCCCCTTGCGCGCTGCGCGCATTGTCGTCAGCGATGTCGAGGGCGAGCCTGGCTGGTACCGGGTCAA
CGTTACGGTACGCCCGCATTTCAAATACATGGGGGCAGACTTCACGTTGTCCCTGGTCGGGAAGCTCGAT
AAAGAATGA