SecReT6
Protein ID: 387893596
SecReT6 ID656
T6SS typei1
Gene symboltssE2
Locus tagPflA506_2410
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]2625858..2626259 [+]
Producttype VI secretion protein TssE2
NoteTssE
UniProt IDI2BU36
KEGG IDpfc:PflA506_2410
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.10E-17, Aligned region: 21..108
Protein Sequence: 133 a.a.     [Download]
>gi|387893596|ref|YP_006323893.1| type VI secretion protein TssE2 [Pseudomonas fluorescens A506]
MLEHNSLFERLEQGASNPGATVASIAAHLGKMLSTRAGSVQTLPDYGLPDLNDMRLSLHESLSQSRLHIE
RFIQAYEPRLTNVRVRLLPVVRDSLSLAFAIEAERMIEGVLHPVVFHARLTDTGRVEVCANDA
 
Nucleotide Sequence: 402 bp     [Download]
>gi|387891255|ref|NC_017911.1|:2625858-2626259 Pseudomonas fluorescens A506 chromosome, complete genome
ATGCTTGAGCACAACAGCCTTTTCGAACGCCTCGAGCAGGGGGCGTCTAACCCGGGTGCCACCGTGGCGT
CCATCGCCGCACATTTGGGGAAAATGCTCAGCACTCGTGCGGGCAGTGTCCAGACGCTGCCTGATTATGG
CTTGCCTGACCTCAATGACATGCGGCTCAGCTTGCATGAGTCCTTGAGCCAGTCGCGGCTGCATATCGAA
CGTTTTATCCAGGCCTATGAGCCGCGGCTGACGAACGTACGTGTCAGGCTGTTGCCGGTTGTGCGTGACT
CCTTGTCCCTGGCATTCGCCATTGAGGCTGAGCGGATGATTGAGGGCGTACTGCATCCTGTAGTGTTCCA
CGCGCGCCTCACGGATACCGGGCGGGTTGAGGTCTGTGCCAATGACGCTTAA