SecReT6
Protein ID: 387893597
SecReT6 ID656
T6SS typei1
Gene symboltssF2
Locus tagPflA506_2411
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]2626249..2628036 [+]
Producttype VI secretion protein TssF2
NoteTssF
UniProt IDI2BZV8
KEGG IDpfc:PflA506_2411
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-181, Aligned region: 3..595
Protein Sequence: 595 a.a.     [Download]
>gi|387893597|ref|YP_006323894.1| type VI secretion protein TssF2 [Pseudomonas fluorescens A506]
MTLNRYFQSELSALRQLGRRFSERNPALAPFLGEAGQDPDVERLLEGFAFLTGRLRQKLDDELPELTHSL
MHLLWPHYMRPIPAFSILQFDPLKRAGPSVRVARDTAVQSAPIHGERCQFRTCYPTDVMPLQLTDLEYKC
QGEGAWLALRLCMSVDGSFSELEFDSLRLHLAGDHYISQGLYLGLLRHLAGISLQLVDHDGLPISAGDDQ
PLTLRLNANQVRPVGFSQEQALIPYPQNTLEGYRHLQEYFAFPEKYLFVDVEGLEVLHTLSHELLRQAHG
LVMRFELRSQGREPLRPTLDNVKLYCTPIVNLFTQDAIPIRLDGKQDEYLLVPGEYTPGNASVYSVDRVT
GWRPGGLGYQTYVRFESFEHDCHSEPVAAPPSYSIRQRSSVQHGGLDTWMGFGNRRKQGQETLSVELTCT
NCNLPRQLRAGDINQPGEHTPESLTFRNITAPTASYAPPLDQDFLWNLISNMSLNYLSLIDINALKAILA
TYDLPRYYDRQALKVSQKRLAALRAIHHEATDRLHRGLPVRGGRVDLTVDSQGFVGQGDLFVFASVLNQF
FALYASLNSHHELRVISTQGDVYLWPSLTGQQPLL
 
Nucleotide Sequence: 1788 bp     [Download]
>gi|387891255|ref|NC_017911.1|:2626249-2628036 Pseudomonas fluorescens A506 chromosome, complete genome
ATGACGCTTAACCGTTATTTTCAAAGCGAACTCAGTGCGTTGCGCCAACTGGGGCGACGTTTTTCCGAAC
GTAATCCCGCCCTGGCGCCGTTTCTCGGCGAAGCGGGCCAGGACCCGGATGTCGAGCGCTTGCTGGAGGG
CTTTGCATTCCTGACCGGGCGCTTGCGTCAGAAGCTGGATGACGAACTGCCGGAGTTGACGCACTCGTTG
ATGCACTTGCTCTGGCCCCATTACATGCGCCCGATACCGGCCTTCAGCATCTTGCAATTCGACCCGTTGA
AACGCGCCGGCCCAAGCGTTCGGGTGGCTCGGGATACCGCCGTGCAAAGCGCTCCCATCCACGGTGAGCG
TTGCCAGTTCCGTACATGCTATCCCACCGATGTCATGCCATTGCAACTCACTGACCTGGAATACAAATGC
CAGGGCGAAGGGGCCTGGTTGGCTTTGCGCCTGTGCATGAGTGTCGACGGCAGCTTCAGTGAGTTGGAAT
TCGATTCGCTGCGACTGCACCTGGCCGGCGACCACTACATCAGTCAGGGCCTGTACCTGGGCCTATTGCG
CCATCTGGCGGGAATCAGCCTGCAGCTCGTGGATCACGATGGCCTGCCGATCAGCGCCGGCGATGACCAA
CCCCTGACGCTGCGGCTCAATGCCAACCAGGTCCGGCCAGTGGGGTTTTCCCAGGAACAGGCGCTGATTC
CTTATCCGCAGAACACGCTGGAGGGCTATCGGCACCTGCAGGAGTACTTCGCGTTTCCCGAGAAGTACCT
GTTTGTCGATGTCGAAGGCTTGGAGGTGTTGCACACGTTGTCTCACGAGTTGCTCCGGCAGGCGCACGGC
CTGGTGATGCGTTTCGAGCTCCGCAGTCAGGGCCGCGAGCCCCTGCGTCCTACCTTGGATAACGTAAAGC
TGTATTGCACGCCCATCGTCAACCTGTTTACTCAGGATGCAATTCCCATTCGCCTGGACGGTAAACAGGA
CGAGTACCTTTTGGTACCTGGGGAATACACGCCGGGCAATGCCAGCGTGTATTCAGTGGACCGGGTCACC
GGCTGGCGCCCCGGTGGCTTGGGCTATCAAACCTACGTGCGGTTCGAGTCGTTTGAACATGACTGCCACA
GCGAGCCTGTGGCGGCACCGCCCAGCTACAGCATTCGCCAACGTTCGTCGGTTCAACATGGTGGACTCGA
CACCTGGATGGGGTTCGGCAATCGCCGCAAACAGGGCCAGGAAACCCTGTCGGTCGAACTGACCTGTACC
AATTGCAACCTGCCACGGCAATTACGTGCAGGCGATATCAACCAGCCCGGCGAACACACACCGGAGTCGT
TGACGTTTCGCAATATCACCGCGCCAACGGCGAGCTACGCACCGCCCCTGGACCAGGATTTCCTGTGGAA
TCTCATCAGCAATATGTCGCTCAACTACTTGTCGTTGATCGACATCAACGCCTTGAAGGCGATTCTCGCA
ACCTACGACCTGCCGCGTTATTACGACCGCCAGGCGCTGAAGGTCAGCCAGAAAAGACTGGCGGCTTTGC
GCGCCATCCATCATGAGGCGACGGATCGCCTGCATCGTGGGTTGCCCGTGCGAGGGGGGCGGGTCGATCT
GACGGTCGATTCCCAAGGCTTTGTCGGCCAGGGCGACTTATTTGTATTCGCTTCGGTCCTCAATCAGTTC
TTTGCGCTTTATGCCAGCCTCAATTCCCATCACGAGTTGCGTGTCATCAGCACACAAGGAGACGTGTATT
TATGGCCATCCCTGACGGGACAACAGCCCCTGCTCTGA