SecReT6
Protein ID: 387893598
SecReT6 ID656
T6SS typei1
Gene symboltssG2
Locus tagPflA506_2412
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]2628000..2629007 [+]
Producttype VI secretion protein TssG2
NoteTssG
UniProt IDI2BM65
KEGG IDpfc:PflA506_2412
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.00E-82, Aligned region: 20..321
Protein Sequence: 335 a.a.     [Download]
>gi|387893598|ref|YP_006323895.1| type VI secretion protein TssG2 [Pseudomonas fluorescens A506]
MAIPDGTTAPALNQLCRGIREYTLFQAVLQVIERLREAHPLLDEDALYDQLEFQANPGLGFAAHDIDRVE
FFMEHGHLRARLRLNVLGLFGAGSPLPAFYGEQAFAEQPGGNPTRDFLDMFHHRLHRLMLPIWRKYRYRA
CFRAGASDGFSEQMFALTGLGGTAIRGASQLDCKRLLPYLGLLSVRVHSAALIESVLRYYFKHDALFIEQ
WVERQVEISPVQRNDLGRANSVLGEDLVLGRRVADRSGKFRVHVRALGWQRFHDFLPTGKAYQPLRSLVR
LTLRDPLEYDLRLVLAQGQIRALHIGENTVCRLGWTTWLGHERADGVVTLTRNFH
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|387891255|ref|NC_017911.1|:2628000-2629007 Pseudomonas fluorescens A506 chromosome, complete genome
ATGGCCATCCCTGACGGGACAACAGCCCCTGCTCTGAATCAACTTTGCCGTGGTATCCGTGAATACACGT
TGTTCCAGGCGGTTTTGCAGGTGATCGAGCGATTGCGTGAGGCTCATCCGCTGCTGGATGAGGACGCGTT
GTACGACCAGTTGGAGTTCCAGGCCAACCCTGGCTTGGGCTTTGCCGCGCACGATATCGACCGAGTGGAG
TTCTTTATGGAGCATGGACATTTGCGCGCACGCCTGCGCCTCAATGTACTGGGGTTATTTGGCGCCGGGT
CCCCACTGCCTGCGTTTTATGGTGAGCAGGCATTTGCCGAGCAGCCAGGCGGCAACCCGACTCGAGATTT
CCTGGATATGTTCCATCATCGCTTGCACCGGCTGATGCTCCCGATCTGGCGCAAGTACCGCTATCGGGCG
TGTTTCCGGGCAGGCGCCAGTGATGGTTTTTCCGAGCAGATGTTTGCCTTGACGGGTCTGGGCGGCACCG
CAATCCGTGGCGCTTCCCAGCTCGATTGCAAACGCCTGCTGCCCTACCTGGGCCTGCTGAGTGTGCGTGT
GCACTCGGCGGCGTTGATCGAGTCGGTCCTGCGCTACTACTTCAAGCACGACGCGTTGTTTATCGAGCAG
TGGGTTGAACGCCAGGTCGAGATCAGCCCGGTCCAGCGCAATGACCTGGGGCGGGCCAACAGTGTGCTTG
GCGAGGACCTGGTGCTGGGGCGCCGCGTCGCTGACCGCAGTGGCAAGTTCAGGGTGCATGTCCGCGCGTT
GGGGTGGCAGCGTTTTCACGACTTCCTGCCCACGGGAAAGGCCTATCAGCCGCTGCGTTCGCTGGTGCGC
CTGACCCTGCGCGACCCATTGGAATACGACCTGCGTCTGGTACTGGCGCAGGGTCAGATCAGGGCTCTGC
ACATTGGCGAAAACACGGTTTGCCGCCTGGGTTGGACCACCTGGCTGGGGCACGAGCGGGCCGATGGCGT
AGTCACGCTAACCCGTAATTTTCATTAG