SecReT6
Protein ID: 387893602
SecReT6 ID656
T6SS typei1
Gene symboltssJ2
Locus tagPflA506_2416
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]2632022..2632507 [+]
Producttype VI secretion lipoprotein TssJ2
NoteTssJ
UniProt IDI2BV06
KEGG IDpfc:PflA506_2416
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.30E-34, Aligned region: 14..149
Protein Sequence: 161 a.a.     [Download]
>gi|387893602|ref|YP_006323899.1| type VI secretion lipoprotein TssJ2 [Pseudomonas fluorescens A506]
MYRATFVSLLLLCGLLAGCSAVSPFSTLTKLDVVLTASEHVNPDLHGRPSPVVVQLIELRHGVAFEHADF
FSLYGNAQHTLPKDWVGSEEVELRPGDRLALKLRIAPDSRFVGVLAAFRDLPHVQWRLLVPLTVQQRNRV
ELVLDQGGIRVADPLAGVEAQ
 
Nucleotide Sequence: 486 bp     [Download]
>gi|387891255|ref|NC_017911.1|:2632022-2632507 Pseudomonas fluorescens A506 chromosome, complete genome
ATGTATCGAGCCACCTTTGTTTCGTTGTTGCTCTTGTGCGGGCTGTTGGCGGGTTGCAGCGCCGTCTCGC
CATTTTCCACGCTGACCAAGCTGGACGTGGTGCTGACTGCCAGCGAGCACGTCAACCCGGACTTGCACGG
TCGTCCTTCTCCCGTGGTGGTGCAGTTGATCGAACTGCGCCATGGCGTTGCCTTTGAACATGCCGACTTC
TTCAGCCTGTATGGCAATGCGCAGCACACGCTGCCAAAGGACTGGGTCGGCAGCGAGGAGGTTGAGCTGC
GCCCGGGTGACCGGCTGGCGCTCAAACTGCGCATCGCTCCCGATAGTCGTTTTGTGGGAGTACTGGCCGC
TTTTCGAGACTTGCCCCATGTCCAGTGGCGGCTGCTGGTGCCCTTGACGGTACAGCAACGCAACCGTGTC
GAGCTGGTGCTGGACCAGGGCGGTATACGTGTTGCTGACCCGCTCGCCGGTGTGGAGGCGCAATAA