SecReT6
Protein ID: 387893603
SecReT6 ID656
T6SS typei1
Gene symboltssK2
Locus tagPflA506_2417
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]2632509..2633837 [+]
Producttype VI secretion protein TssK2
NoteTssK
UniProt IDI2BP36
KEGG IDpfc:PflA506_2417
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.00E-124, Aligned region: 18..441
Protein Sequence: 442 a.a.     [Download]
>gi|387893603|ref|YP_006323900.1| type VI secretion protein TssK2 [Pseudomonas fluorescens A506]
MQVHKVIWQEGMLLRPQHLQHNDRYYHQQLNQTRLLGSNTWGLLTFELNTQYLKLGKLVVNQASGVLPDG
SLFDLNAAMEPLVVQVPEGSGAQGVYLALPLVSGSHLEARRPEQSDVLARYLSCEVEVGDSNVGADTRCR
IHCARPDLRLLLGEQPGDQHFIKLKVAQVLDASGEGGVNLDTAFIPTFIFVQEHGYVASCLKEVIGLLAS
RGDAIAARIRGESTTQGTQIADFLMLQVINRSELELRHCLSQTRVRPEAVFRALVSLLGELSTFTTESKR
AQLDVHYQHGDQGASFRGLMAQVRTALSVVLEQQAIKLALQPRQYGVLVCPVSELKLLGTATFILAATAQ
CEAQELRQRLPAHLKVAPVERIRELVNLHLAGIKVKPLPVAPRQIPFHAGKTYFVLDMSPRDIAQLEQSG
GFAFHVGGEFTGLELDFWAIRN
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|387891255|ref|NC_017911.1|:2632509-2633837 Pseudomonas fluorescens A506 chromosome, complete genome
ATGCAGGTTCATAAAGTTATCTGGCAGGAAGGCATGCTGTTGCGGCCACAGCACTTGCAACACAACGACC
GTTATTACCACCAGCAGCTCAATCAGACCCGCCTGCTGGGCAGTAACACCTGGGGTTTGCTCACGTTCGA
ACTCAATACGCAGTACCTCAAGTTGGGCAAGCTGGTGGTCAACCAGGCCAGCGGCGTGTTGCCGGACGGC
AGCCTGTTTGACTTGAATGCTGCCATGGAGCCGCTGGTGGTGCAGGTGCCAGAGGGTTCGGGCGCGCAAG
GGGTTTACCTGGCGCTGCCGCTGGTCAGCGGCAGTCACCTTGAAGCCCGCCGGCCTGAGCAAAGTGACGT
GTTGGCGCGCTACCTCAGCTGTGAAGTGGAAGTGGGGGATTCCAACGTGGGGGCGGATACGCGTTGCCGA
ATCCACTGCGCGCGCCCGGACTTACGTCTTCTGTTGGGTGAACAGCCGGGTGACCAGCACTTCATCAAGC
TCAAGGTGGCCCAGGTACTCGACGCCAGCGGTGAAGGCGGTGTGAACCTGGATACGGCGTTCATCCCGAC
GTTTATCTTCGTGCAGGAGCATGGGTACGTGGCGTCGTGTCTCAAGGAGGTGATTGGCCTGCTTGCCAGT
CGGGGCGATGCCATCGCGGCGCGCATTCGTGGCGAGAGCACGACCCAAGGCACACAAATCGCCGATTTCC
TGATGCTGCAAGTGATCAATCGTAGTGAGCTGGAGCTGCGCCACTGCCTGAGCCAGACGCGGGTGCGGCC
TGAAGCGGTGTTCCGTGCGCTGGTGTCGCTGCTCGGGGAGCTATCAACCTTCACCACTGAAAGTAAGCGC
GCGCAGTTGGATGTTCACTATCAACACGGCGATCAGGGCGCCAGTTTTCGCGGGCTGATGGCGCAGGTGC
GTACGGCACTGTCGGTGGTGCTGGAGCAACAGGCGATCAAGTTGGCATTGCAGCCTCGCCAGTACGGGGT
GCTGGTATGCCCGGTCAGCGAGTTGAAACTGCTTGGCACAGCCACCTTCATCCTGGCGGCCACCGCGCAG
TGTGAGGCGCAGGAATTGCGCCAGCGCCTGCCAGCCCACCTGAAAGTCGCGCCGGTTGAGCGCATACGCG
AGTTGGTCAACCTGCACTTGGCCGGTATCAAGGTCAAGCCTTTGCCAGTGGCGCCGCGACAGATTCCTTT
CCATGCCGGCAAGACCTATTTCGTGCTCGATATGAGCCCCCGTGATATCGCACAGCTGGAACAGTCGGGT
GGTTTCGCTTTCCACGTAGGGGGTGAATTCACCGGGCTTGAACTCGACTTCTGGGCCATCAGGAACTGA