SecReT6
Protein ID: 387893604
SecReT6 ID656
T6SS typei1
Gene symboltssL2
Locus tagPflA506_2418
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]2633843..2634703 [+]
Producttype VI secretion protein TssL2
NoteTssL
UniProt IDI2BRX8
KEGG IDpfc:PflA506_2418
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.20E-63, Aligned region: 59..263
Protein Sequence: 286 a.a.     [Download]
>gi|387893604|ref|YP_006323901.1| type VI secretion protein TssL2 [Pseudomonas fluorescens A506]
MDSEYTQDEKTVLLDRETHEPAQGPLTDFPSPPRYEQLEDRMIYAGHRLDTHSFQTGLNPLVAAALAVLF
EVIGIRVCSGRENLGTLNDRLVLAVTQFETRALQGGVENSQVMSARYVLCSVIDEAVVTTPWGAQSEWSK
MSLLSRFHNETFGGEKVFQLLERLTRDPVKHLAMLELLYLCLSLGFEGKYRVMERGVTQLEAVRDALYRQ
IRHVRGEPAAQALLPAQQRTDRRKQVRVIPATWWVGLTLVCVLAMYTGFAWVLSNERTNALHPLQLSASD
LVRTPL
 
Nucleotide Sequence: 861 bp     [Download]
>gi|387891255|ref|NC_017911.1|:2633843-2634703 Pseudomonas fluorescens A506 chromosome, complete genome
ATGGACAGTGAATACACCCAGGATGAAAAAACCGTCCTGCTCGACCGGGAGACTCATGAGCCTGCCCAGG
GGCCGTTGACGGATTTCCCATCGCCGCCGCGCTACGAACAGTTGGAAGACCGCATGATCTACGCCGGCCA
CAGGCTCGATACGCATAGCTTTCAGACAGGGCTCAACCCGCTGGTAGCCGCAGCCTTGGCGGTATTGTTC
GAGGTTATTGGGATCAGGGTCTGCTCCGGCCGTGAAAACCTGGGCACGCTCAACGACCGATTAGTGTTGG
CGGTGACTCAGTTCGAAACCCGCGCCTTGCAGGGCGGCGTGGAGAACAGCCAGGTCATGTCGGCGCGCTA
TGTGTTGTGCAGCGTGATCGACGAGGCGGTGGTGACGACACCGTGGGGGGCGCAAAGCGAATGGTCGAAG
ATGAGCCTGTTGAGCCGCTTCCATAACGAAACCTTTGGCGGCGAAAAAGTATTCCAGTTGCTGGAGCGCC
TCACGCGCGACCCGGTGAAGCACCTGGCGATGCTGGAGTTGCTGTATCTGTGCCTGTCCCTGGGGTTCGA
AGGCAAATACCGGGTGATGGAGCGGGGCGTGACGCAACTTGAGGCTGTCCGCGATGCCTTGTATCGCCAG
ATCAGGCACGTACGTGGGGAGCCGGCGGCGCAAGCGCTACTGCCTGCCCAGCAGCGGACCGACCGGCGCA
AGCAGGTGCGGGTCATCCCTGCCACTTGGTGGGTCGGCCTCACCTTGGTGTGTGTGTTGGCGATGTACAC
AGGGTTTGCCTGGGTGCTGAGCAACGAGCGTACAAACGCGCTGCACCCCCTTCAACTTTCGGCGTCGGAT
CTGGTCCGCACGCCCTTGTAA