SecReT6
Protein ID: 387896383
SecReT6 ID657
T6SS typei3
Gene symboltagF
Locus tagPflA506_5294
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]5793535..5794188 [-]
Producttype VI secretion-associated protein TagF
NoteTagF
UniProt IDI2BR75
KEGG IDpfc:PflA506_5294
PDB IDNA
Domain hit(s) vs Pfam DUF2094 [PF09867], Evalue: 8.60E-49, Aligned region: 5..142
DUF2094 [PF09867], Evalue: 8.60E-49, Aligned region: 200..208
Protein Sequence: 217 a.a.     [Download]
>gi|387896383|ref|YP_006326680.1| type VI secretion-associated protein TagF [Pseudomonas fluorescens A506]
MTALGFYGKLASRGDFVSRALPQSFIGPWDSWLAAGLLASQNSLGADWLNAYLVSPLWRFVLAPGVCGPD
AAAGVVMPSIDRVGRYFPLAVVTLLDHDTNPASLVGGSDAWFEQAETLLLSTLDSGATFESFNAGLDELG
VPASEPRAVDSRFAGLQRVAATVPHQRMTALAEQACEGASLWWGRGSQRISPGLLRCQGLPAASDFAQFL
LGQEGVV
 
Nucleotide Sequence: 654 bp     [Download]
>gi|387891255|ref|NC_017911.1|:c5794188-5793535 Pseudomonas fluorescens A506 chromosome, complete genome
ATGACGGCCCTGGGTTTCTACGGCAAGTTGGCCAGCCGCGGGGACTTCGTCAGCCGCGCCTTGCCGCAGA
GCTTTATCGGCCCGTGGGACAGCTGGCTGGCGGCGGGTTTGCTCGCCAGCCAGAACAGCCTCGGCGCTGA
CTGGCTGAATGCGTACCTGGTCAGCCCGTTGTGGCGCTTTGTGCTGGCGCCGGGCGTGTGCGGGCCGGAC
GCGGCGGCGGGCGTGGTGATGCCGAGCATTGACCGGGTCGGGCGTTACTTTCCGCTGGCGGTGGTGACCT
TGCTGGATCACGACACCAACCCGGCGTCGCTGGTGGGCGGTTCGGACGCCTGGTTCGAGCAGGCTGAAAC
CTTGTTGCTCAGCACCCTCGACAGCGGCGCGACCTTCGAAAGCTTCAACGCCGGGCTCGACGAGTTGGGT
GTGCCGGCCAGCGAGCCGCGGGCGGTGGACAGCCGTTTCGCCGGCCTGCAAAGGGTGGCAGCCACCGTGC
CGCACCAGCGTATGACCGCACTGGCCGAACAGGCATGCGAGGGCGCAAGCCTGTGGTGGGGGCGAGGCTC
GCAGCGTATCTCCCCCGGTTTATTACGGTGCCAGGGCCTGCCTGCCGCCAGCGATTTTGCGCAGTTTTTG
CTCGGACAAGAAGGTGTGGTGTAG