SecReT6
Protein ID: 387896385
SecReT6 ID657
T6SS typei3
Gene symboltssL1
Locus tagPflA506_5296
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]5797682..5798971 [-]
Producttype VI secretion protein TssL1
NoteTssL
UniProt IDI2BNV0
KEGG IDpfc:PflA506_5296
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.00E-70, Aligned region: 46..251
OmpA [PF00691], Evalue: 2.90E-15, Aligned region: 319..417
DUF883 [PF05957], Evalue: 0.00082, Aligned region: 70..120
DUF883 [PF05957], Evalue: 0.00082, Aligned region: 182..248
DUF883 [PF05957], Evalue: 0.00082, Aligned region: 316..354
Protein Sequence: 429 a.a.     [Download]
>gi|387896385|ref|YP_006326682.1| type VI secretion protein TssL1 [Pseudomonas fluorescens A506]
MHPNDDDRTQFMPRPGGREPAPARAEPAPLSMPAAPILTGKSQGLNPLESAAGPLLALLTRLRNTIAHPA
PASLRAQLLAYLRQFEERAEAAGVARNEVLLARYALCTALDEAVLSTPWGSTSDWGKQSLLITVHNEAWG
GEKVFQLLDHCLQSPRERLYLLELLYLCMCLGFEGRYRVMTDGRSQLEALRERTAAAIRSARGEHERELS
PHWRGVTVARDRLAQFMPPWIAVAIGLALLLALLFGLRLKLASDAEPVFKNIHALGEIPVQAIDRPVAQP
KVIERPRLAGFLADDIKAGRVAVEDKVDRSVVTIRGDELFASASSSIVDDYQPLMLRIADAIRKVKGQVR
VTGHSDNRPIATLRFPSNWALSEARAKSVLAILAAKTGQAERFSAEGRSDTEPLATNSTAEGRARNRRVE
ITVLAEGVE
 
Nucleotide Sequence: 1290 bp     [Download]
>gi|387891255|ref|NC_017911.1|:c5798971-5797682 Pseudomonas fluorescens A506 chromosome, complete genome
ATGCATCCCAATGATGATGACCGCACCCAGTTCATGCCGCGCCCGGGTGGCCGAGAACCTGCACCCGCGC
GTGCCGAACCTGCGCCGCTGTCGATGCCGGCTGCGCCGATCCTCACCGGCAAGAGCCAGGGCCTCAACCC
GCTGGAAAGTGCCGCCGGCCCGTTGCTGGCGTTGTTGACGCGGTTGCGCAACACCATCGCCCATCCCGCG
CCGGCCAGCCTGCGTGCGCAGTTGCTGGCGTACCTGCGCCAGTTCGAAGAGCGCGCCGAAGCCGCCGGTG
TGGCACGCAATGAAGTGCTGTTGGCCCGTTACGCGCTGTGCACTGCCTTGGATGAGGCGGTGCTGAGCAC
GCCGTGGGGCAGCACCAGTGACTGGGGTAAGCAGAGCCTGCTGATCACCGTGCACAACGAAGCCTGGGGT
GGTGAAAAGGTTTTCCAGTTGCTTGACCACTGTCTGCAAAGCCCACGGGAACGCCTGTACCTGCTGGAGC
TGTTGTACCTGTGCATGTGCCTGGGTTTTGAAGGGCGTTACCGCGTGATGACCGACGGGCGCAGCCAGTT
GGAAGCCTTGCGTGAACGCACCGCCGCAGCGATACGCAGCGCCCGTGGCGAGCACGAGCGTGAGCTGTCG
CCGCACTGGCGCGGTGTAACCGTGGCCCGTGATCGCCTGGCGCAATTCATGCCGCCATGGATTGCCGTGG
CGATTGGCTTGGCGCTGCTGTTGGCGTTGCTGTTCGGCCTGCGCCTGAAGCTGGCCTCGGACGCCGAGCC
GGTGTTCAAGAATATTCATGCCCTGGGCGAGATCCCGGTGCAGGCCATCGACCGTCCGGTGGCGCAGCCC
AAAGTGATTGAGCGCCCGCGCCTGGCCGGGTTCCTGGCCGACGACATCAAGGCCGGCCGCGTGGCGGTGG
AAGACAAGGTCGACCGCTCTGTCGTGACCATTCGTGGCGATGAGCTGTTCGCCTCGGCCAGCTCCAGCAT
CGTCGATGACTACCAGCCGCTGATGCTGCGCATCGCTGACGCCATTCGCAAGGTCAAGGGCCAGGTGCGT
GTCACCGGGCACAGCGACAACCGCCCGATTGCCACGTTGCGTTTCCCGTCCAACTGGGCGTTGTCCGAAG
CCCGGGCCAAGTCGGTGCTGGCGATTCTCGCGGCCAAGACCGGCCAGGCCGAACGCTTCAGCGCCGAAGG
CCGCAGCGACACCGAGCCGTTGGCCACCAACAGTACTGCCGAAGGCCGTGCCCGCAATCGTCGGGTTGAA
ATCACCGTATTGGCGGAGGGCGTCGAGTGA