SecReT6
Protein ID: 387896386
SecReT6 ID657
T6SS typei3
Gene symboltssK1
Locus tagPflA506_5297
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]5798978..5800312 [-]
Producttype VI secretion protein TssK1
NoteTssK
UniProt IDI2BZP2
KEGG IDpfc:PflA506_5297
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.30E-157, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|387896386|ref|YP_006326683.1| type VI secretion protein TssK1 [Pseudomonas fluorescens A506]
MSWNNRVVWSEGMFIGTQHFQQHDRYLENLIDARSRPLSAGAWGFSELLIDQGLLAQGKLAIVSARGLLP
DGTPFNIPQDDLAPSPLNIDDNLRDGLVYLALPLKRAGARDTVDEGEALEAARYVSQVREVRDDNAPFEN
RAPVAVGSRALRLLTAQDGISDYAAIGLVRIKEKRADRALVLDDTYIPPVLDVAASKPLTAFRSELLGLL
HQRGEALAGRVVASGAGGASEIADFMLLQLVNRAQPLIQHFSQLSPLHPERFFSELVSLAGEFSTFSTSS
RRPQEYPQYQHDDLALSFMPVMAALREALSMLIDSKATPIPIVEKAYGIHVAMLADKTLLDNASFILVVR
ADVPGETLRARFGQQSKVGSVEHIRDMVNLQLPGIGLLPLPVAPRQLPYHAGSTYYELDRGSEHWQQLNN
SGGFAFHIAGQFPGLNLAFWAIRG
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|387891255|ref|NC_017911.1|:c5800312-5798978 Pseudomonas fluorescens A506 chromosome, complete genome
ATGTCCTGGAACAATCGCGTGGTCTGGTCGGAAGGCATGTTCATCGGAACGCAGCACTTCCAGCAGCATG
ACCGTTACCTGGAAAACCTGATCGATGCCCGCAGCCGTCCGTTGTCAGCGGGTGCCTGGGGGTTCTCCGA
ACTGCTGATCGACCAGGGCCTGCTGGCCCAGGGCAAGCTGGCGATTGTGTCGGCCCGCGGCCTGCTGCCC
GATGGCACGCCGTTCAATATTCCCCAGGACGACCTGGCGCCGAGCCCGTTGAACATCGACGACAACCTGC
GCGACGGCCTGGTGTACCTGGCCCTGCCGCTCAAGCGCGCCGGCGCCCGTGACACGGTGGACGAGGGTGA
AGCCCTGGAAGCCGCGCGCTACGTGAGCCAGGTGCGTGAAGTGCGCGACGACAACGCCCCGTTCGAAAAC
CGTGCACCGGTGGCGGTGGGCTCGCGGGCATTGCGCCTGCTGACGGCGCAGGACGGCATCAGCGACTACG
CCGCCATCGGCCTGGTACGCATCAAGGAAAAGCGTGCCGACCGTGCGTTGGTGCTCGATGACACTTACAT
CCCGCCCGTGCTGGACGTGGCCGCAAGCAAGCCGCTGACGGCCTTTCGCAGCGAACTGCTGGGCCTGTTG
CACCAGCGTGGCGAAGCCCTGGCCGGCCGCGTTGTGGCCTCGGGTGCCGGGGGGGCCTCTGAGATCGCCG
ACTTCATGCTGTTGCAACTGGTCAACCGCGCCCAGCCGCTGATCCAGCACTTCAGCCAGTTGAGCCCGTT
GCACCCGGAGCGCTTCTTCAGCGAACTGGTCAGCCTGGCCGGTGAGTTTTCCACCTTCTCAACCTCCAGC
CGTCGCCCCCAGGAATACCCGCAGTACCAGCACGACGACCTGGCCCTGAGCTTCATGCCGGTGATGGCGG
CCCTGCGTGAAGCGCTGTCGATGCTCATCGACAGCAAGGCCACGCCGATCCCCATTGTGGAGAAAGCCTA
CGGCATCCATGTGGCGATGTTGGCCGACAAGACCCTGCTCGACAACGCCAGTTTCATCCTCGTGGTACGC
GCCGATGTGCCCGGCGAAACCCTGCGTGCGCGTTTCGGCCAGCAGAGCAAGGTCGGCTCGGTGGAGCACA
TCCGCGACATGGTCAACCTGCAACTGCCGGGCATCGGCCTGCTGCCGTTGCCGGTGGCGCCACGCCAGTT
GCCTTACCACGCTGGCAGCACCTACTACGAGCTGGACCGTGGCAGCGAGCACTGGCAGCAGCTGAATAAT
TCCGGCGGTTTCGCCTTCCATATCGCCGGGCAGTTCCCGGGCTTGAACCTGGCCTTCTGGGCGATCCGAG
GATAA