SecReT6
Protein ID: 387896387
SecReT6 ID657
T6SS typei3
Gene symboltssJ1
Locus tagPflA506_5298
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]5800331..5800840 [-]
Producttype VI secretion lipoprotein TssJ1
NoteTssJ
UniProt IDI2BXU5
KEGG IDpfc:PflA506_5298
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.70E-39, Aligned region: 12..155
Protein Sequence: 169 a.a.     [Download]
>gi|387896387|ref|YP_006326684.1| type VI secretion lipoprotein TssJ1 [Pseudomonas fluorescens A506]
MIPRFLLAAATALLLTACANDTAKPQAAAEAEADTAAVELHFHAIAGLNPGANGQAAPVRVRIFELKNAA
IFSRSDYFALADRAQSTLGLDLLDQDEVMVQPGQQLSLQRDLDPSTRQIGLLVGYRELDRAQWRTVINVP
PRQYSEYQISLDVHAVRADVVASPSSPAQ
 
Nucleotide Sequence: 510 bp     [Download]
>gi|387891255|ref|NC_017911.1|:c5800840-5800331 Pseudomonas fluorescens A506 chromosome, complete genome
ATGATTCCCAGGTTTTTACTCGCAGCCGCCACCGCGCTGCTGCTGACGGCGTGTGCCAACGACACTGCCA
AACCCCAGGCGGCTGCCGAGGCCGAAGCTGACACGGCCGCCGTTGAGCTGCATTTTCATGCGATTGCCGG
GCTTAACCCCGGTGCCAACGGCCAGGCCGCGCCGGTGCGGGTGCGCATTTTCGAATTGAAAAACGCCGCG
ATCTTTTCACGCTCCGATTACTTCGCCCTGGCGGACCGTGCGCAATCGACCCTCGGCCTCGACCTGCTGG
ACCAGGACGAAGTGATGGTGCAGCCCGGCCAACAACTGAGCCTGCAGCGCGATCTCGACCCGTCCACGCG
CCAGATCGGCTTGCTGGTGGGCTACCGCGAGTTGGACCGTGCGCAATGGCGCACGGTCATCAACGTGCCG
CCGCGCCAATACAGCGAATACCAGATCAGCCTCGACGTGCATGCCGTGCGCGCCGACGTCGTGGCTTCCC
CATCCAGCCCAGCCCAATAA