SecReT6
Protein ID: 387896390
SecReT6 ID657
T6SS typei3
Gene symboltssB1
Locus tagPflA506_5301
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]5803694..5804200 [+]
Producttype VI secretion protein TssB1
NoteTssB
UniProt IDI2BRF5
KEGG IDpfc:PflA506_5301
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.50E-60, Aligned region: 10..163
Protein Sequence: 168 a.a.     [Download]
>gi|387896390|ref|YP_006326687.1| type VI secretion protein TssB1 [Pseudomonas fluorescens A506]
MAKQSSQKFIARNRAPRVQIEYDVELYGAEKKVQLPFVMGVMADLAGKPAEPLAPVADRKFLEVDVDNFD
SRLKAMQPRVAFHVPNELTGEGNLSLDITFESMDDFSPAAVARKVDSLNQLLEARTQLANLLTYMDGKTG
AEEIIMKAIKDPALLQALASAPKPAGEQ
 
Nucleotide Sequence: 507 bp     [Download]
>gi|387891255|ref|NC_017911.1|:5803694-5804200 Pseudomonas fluorescens A506 chromosome, complete genome
GTGGCGAAGCAAAGTTCTCAGAAATTCATCGCGCGCAACCGTGCGCCTCGAGTGCAGATCGAGTACGACG
TCGAGCTTTACGGCGCCGAGAAAAAGGTCCAGCTGCCCTTCGTGATGGGCGTGATGGCCGACCTCGCCGG
CAAGCCTGCCGAGCCGCTGGCCCCCGTGGCCGACCGCAAGTTCCTTGAGGTGGACGTCGACAACTTCGAC
TCACGCCTCAAGGCCATGCAGCCACGCGTCGCGTTCCACGTACCCAATGAGCTGACAGGCGAAGGCAACC
TGAGCCTGGACATCACCTTCGAAAGCATGGACGACTTCAGCCCGGCCGCCGTGGCCCGCAAGGTCGACTC
CCTGAATCAGCTGCTCGAAGCCCGCACCCAATTGGCCAACCTGCTGACCTACATGGACGGCAAGACTGGC
GCTGAAGAAATCATCATGAAGGCGATCAAGGACCCGGCATTGCTTCAGGCACTTGCCAGCGCGCCCAAGC
CTGCAGGGGAGCAGTAA