SecReT6
Protein ID: 387896391
SecReT6 ID657
T6SS typei3
Gene symboltssC1
Locus tagPflA506_5302
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]5804203..5805699 [+]
Producttype VI secretion protein TssC1
NoteTssC
UniProt IDI2BPM0
KEGG IDpfc:PflA506_5302
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-195, Aligned region: 67..493
BMFP [PF04380], Evalue: 0.00073, Aligned region: 20..79
Protein Sequence: 498 a.a.     [Download]
>gi|387896391|ref|YP_006326688.1| type VI secretion protein TssC1 [Pseudomonas fluorescens A506]
MTDNTAREGSQILGTTEEASEFANLLLQEFKPKTERAREAVETAVRTLAEQALAQTDLVSNDAIKSIESI
IAAIDAKLTAQVNQIIHHQDFQQLESAWRGLHYLVNNTESDEQLKIRVLNISKPDLHKTLKKFKGTAWDQ
SPIFKKMYEEEYGQFGGEPYGCLVGDYYFDQSPPDVELLGELSKVCAAMHSPFIAAASPTVMGMGSWQEL
SNPRDLTKIFTTPEYAGWRSLRESEDSRYIGLTMPRFLARLPYGAKTDPVEAFAFEENTDGADSSKYTWA
NAAYAMAVNINRSFKHYGWCSRIRGIESGGEVENLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGF
MPLLHKKNTDFAAFIGAQSLQKPAEYDDPDATANANLAARLPYLFATCRFAHYLKCIVRDKVGSFKEKDE
MQRWLQDWILNYVDGDPAHSTETTKAQHPLAAAEVIVEEVEGNPGYYNSKFYLRPHYQLEGLTVSLRLVS
KLPSAKSA
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|387891255|ref|NC_017911.1|:5804203-5805699 Pseudomonas fluorescens A506 chromosome, complete genome
ATGACGGACAATACCGCCCGCGAAGGCAGCCAGATCCTGGGTACCACCGAAGAAGCCAGCGAGTTCGCGA
ACCTGCTGCTGCAAGAATTCAAACCCAAGACCGAGCGTGCCCGCGAAGCCGTTGAAACCGCGGTGCGCAC
CCTGGCTGAACAGGCCCTGGCGCAAACCGACCTGGTGTCCAACGACGCGATCAAGTCGATCGAATCGATC
ATCGCCGCCATCGACGCCAAGCTCACCGCCCAGGTCAACCAGATCATCCACCACCAGGATTTCCAACAAC
TGGAAAGCGCCTGGCGTGGCCTGCATTACCTGGTCAATAACACCGAGAGCGATGAGCAACTGAAGATTCG
CGTGCTCAACATCTCCAAGCCAGACCTGCACAAGACCCTGAAGAAATTCAAGGGCACCGCGTGGGACCAG
AGCCCGATCTTCAAGAAGATGTACGAAGAAGAATACGGCCAGTTCGGTGGCGAACCTTACGGCTGCCTGG
TGGGTGACTACTACTTCGACCAGTCGCCGCCCGACGTGGAACTGCTGGGCGAGCTGTCAAAAGTCTGCGC
CGCCATGCACTCGCCTTTCATCGCTGCGGCCTCGCCGACCGTGATGGGCATGGGTTCGTGGCAGGAACTG
TCGAACCCACGCGACCTGACCAAGATCTTCACCACCCCGGAATACGCCGGCTGGCGCTCGCTGCGTGAAT
CGGAAGACTCGCGCTACATCGGCCTGACCATGCCGCGCTTCCTGGCACGCCTGCCGTACGGCGCCAAGAC
CGACCCGGTAGAAGCCTTCGCCTTCGAAGAAAACACCGACGGCGCCGACAGCTCCAAGTACACCTGGGCC
AACGCCGCCTACGCCATGGCAGTGAACATCAACCGTTCGTTCAAGCACTACGGCTGGTGCTCGCGCATCC
GCGGTATCGAGTCTGGTGGTGAAGTGGAAAACCTGCCGGCCCACACGTTCCCTACCGATGACGGTGGCGT
GGACATGAAGTGCCCGACCGAAATCGCCATCAGTGACCGCCGTGAAGCGGAACTGGCGAAGAACGGTTTC
ATGCCGCTGCTGCACAAGAAAAACACCGACTTCGCCGCGTTCATTGGCGCCCAGTCGCTGCAAAAGCCTG
CCGAATACGACGACCCGGACGCCACCGCCAACGCCAACCTGGCCGCACGCCTGCCGTACCTGTTCGCCAC
CTGCCGTTTCGCCCACTACTTGAAGTGCATCGTGCGCGACAAGGTCGGCTCCTTCAAAGAGAAGGACGAA
ATGCAGCGCTGGTTGCAGGACTGGATCCTCAACTACGTCGACGGCGACCCGGCGCACTCCACCGAAACCA
CCAAGGCCCAGCATCCGTTGGCGGCGGCCGAAGTGATCGTGGAAGAAGTCGAAGGCAACCCGGGGTATTA
CAACTCCAAGTTCTACCTGCGCCCGCACTATCAGCTTGAAGGGCTGACGGTGTCGTTGCGCCTGGTATCG
AAACTGCCTTCGGCAAAAAGCGCATAA