SecReT6
Protein ID: 387896394
SecReT6 ID657
T6SS typei3
Gene symboltssF1
Locus tagPflA506_5305
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]5806928..5808787 [+]
Producttype VI secretion protein TssF1
NoteTssF
UniProt IDI2BYD1
KEGG IDpfc:PflA506_5305
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.20E-219, Aligned region: 5..618
Protein Sequence: 619 a.a.     [Download]
>gi|387896394|ref|YP_006326691.1| type VI secretion protein TssF1 [Pseudomonas fluorescens A506]
MNPRLLELYNQELHHVRESAAEFAKEYPKIASRLTLSGMDCADPYVERLLEGFAYLTARVQLKLDAEYPT
FTHNLLEIAYPHYLAPTPSMTVVQLQTDPDEGSLAGGFPLPRDTVLRAALGRETQTCCEYRTAHPVTLWP
LQVSNAEYFGNPAAVLGRLAASEPKAKAGLRLTLRTGAELPFNSLDLDTLPLYLSGADEQPFRLYEQLLG
NACAVFARQPGGDWVERLPQGALRSQGFDDADAAMPVVARAFQGYRLLQEYFALPHRFLFVEFAELRRAV
KRCDGQELELIVLFDRHEPSLEGSVGAAQFLPFCTPAINLFPKRVDRIHLSDRVNEHHVIADRTRPMDFE
IHSLSGITGHGTGPEQPFLPFYAVRDPSRYGRDQAYYSVRREPRVLSSDQRRNGPRSTYVGSETFVSLVD
SRQAPYRHDLRQLGVTALCTNRDLPLFMSVGNGKTDFTLADSAPVLAVRCVAGPSRPRASHAHDAKAWRL
ISQLSLNYLSLSEQGQGAGALRELLRLYGDSNDAALQLQIEGLREVSSKAVTRRLPMPGPIVFGRGLEIT
LEFDENAFRGTGVFLLGAVLERFLARYVSINSFTETVIRTTERGEIMRWKAKPGRRPTL
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|387891255|ref|NC_017911.1|:5806928-5808787 Pseudomonas fluorescens A506 chromosome, complete genome
ATGAACCCGCGCCTGCTGGAGCTGTACAACCAGGAACTGCACCACGTGCGCGAAAGCGCCGCCGAGTTCG
CCAAGGAATACCCGAAGATCGCCAGTCGGCTGACCCTGTCCGGCATGGACTGCGCCGACCCGTACGTCGA
ACGTTTGCTTGAAGGCTTCGCCTATCTCACCGCCCGCGTGCAGCTCAAGCTCGACGCCGAGTACCCGACC
TTCACCCACAACTTGCTGGAAATCGCCTACCCGCACTACCTGGCACCGACGCCGTCGATGACCGTAGTGC
AATTGCAGACCGACCCCGATGAAGGCTCCCTGGCCGGCGGTTTCCCGCTGCCCCGGGACACGGTGCTGCG
TGCCGCCCTGGGCCGTGAAACCCAGACCTGCTGCGAGTACCGCACCGCGCACCCGGTGACGCTGTGGCCG
TTGCAGGTCAGCAACGCCGAATATTTCGGCAACCCCGCCGCCGTGCTCGGACGCCTGGCCGCCAGCGAAC
CGAAAGCCAAGGCCGGCCTGCGCCTGACCCTGCGCACCGGTGCCGAGCTGCCGTTCAACAGCCTCGACCT
GGATACCTTGCCGCTGTACCTGAGCGGCGCTGATGAACAACCGTTTCGCCTCTACGAACAACTGCTGGGC
AATGCCTGCGCGGTGTTTGCGCGCCAGCCCGGTGGCGATTGGGTCGAGCGCCTGCCCCAGGGCGCGTTGC
GCTCGCAGGGGTTCGATGATGCCGATGCGGCCATGCCGGTGGTGGCGCGGGCGTTCCAGGGCTATCGCCT
GTTGCAGGAGTACTTCGCCCTGCCCCATCGCTTCCTGTTCGTTGAGTTCGCCGAGTTGAGACGCGCGGTC
AAGCGGTGTGACGGCCAGGAGCTGGAACTGATCGTGTTGTTCGACCGCCACGAACCGAGCCTGGAAGGCA
GTGTCGGCGCGGCGCAGTTCTTGCCGTTCTGCACGCCCGCCATCAACCTGTTCCCCAAGCGCGTGGACCG
CATCCACTTGTCCGACCGGGTCAATGAACACCATGTGATCGCCGACCGTACGCGGCCGATGGATTTCGAG
ATTCACTCCTTGAGCGGCATTACCGGCCATGGCACCGGACCGGAGCAGCCGTTCTTGCCGTTCTATGCGG
TGCGCGATCCGTCGCGCTATGGCCGCGACCAGGCGTATTACAGCGTGCGCCGCGAGCCACGGGTGCTGTC
CAGCGACCAACGCCGCAATGGCCCACGCTCCACTTATGTGGGCAGTGAAACCTTCGTCAGCCTGGTGGAC
AGCCGCCAGGCGCCGTATCGCCATGACCTGCGCCAACTGGGCGTGACGGCGCTGTGCACCAACCGGGACC
TGCCGCTGTTCATGAGCGTGGGCAACGGCAAGACCGACTTCACCCTGGCCGACAGCGCGCCGGTACTGGC
CGTGCGATGCGTCGCCGGGCCAAGCCGCCCGCGTGCCAGCCACGCACATGACGCCAAGGCCTGGCGCCTG
ATCAGCCAGTTGTCGCTCAACTACCTCTCCTTGAGCGAACAGGGCCAGGGCGCCGGCGCCTTGCGCGAAT
TGCTGCGCCTGTACGGCGACAGCAATGACGCCGCCCTGCAATTGCAGATCGAAGGCCTGCGCGAAGTCAG
CAGCAAGGCGGTGACCCGACGCCTGCCGATGCCTGGCCCGATTGTGTTTGGCCGCGGCCTGGAAATCACC
CTGGAGTTCGATGAAAACGCGTTTCGCGGCACCGGCGTGTTCCTGCTCGGTGCAGTGCTGGAGCGCTTCC
TGGCACGCTACGTGTCGATCAACAGCTTTACCGAGACGGTGATCCGTACCACCGAACGCGGCGAGATCAT
GCGATGGAAAGCCAAGCCCGGACGGCGTCCGACCCTGTGA