SecReT6
Protein ID: 387896395
SecReT6 ID657
T6SS typei3
Gene symboltssG1
Locus tagPflA506_5306
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]5808751..5809794 [+]
Producttype VI secretion protein TssG1
NoteTssG
UniProt IDI2BKF4
KEGG IDpfc:PflA506_5306
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.50E-111, Aligned region: 20..320
Protein Sequence: 347 a.a.     [Download]
>gi|387896395|ref|YP_006326692.1| type VI secretion protein TssG1 [Pseudomonas fluorescens A506]
MESQARTASDPVRTLDAMHQEPWEYDFFQALRRIECETPELPRLGHSLRLADDPLRLGQQADCTFAPATL
ASVAPGGDGKPARLEQFFFGLGGPNGPLPLHITEYVRERQRNNADSTSKQFLDVFHHRLLTLFYRAWAEA
RPTVSHDRPDDDYWSARLAALSGRGMPSLLNQGLIPDTAKLHYSGHLSAQTRYPDGLKAILGEYFGLPVE
IEEYVGQWLELPERSRVGVSANQLGVDFCLGSHVWDRQHKFRIRLGPLTLDNYMGMLPGQQPFNELVAWV
AEYLGHELDWDLNLVLQQPEVPALQLNGQFRLGFNTWLGQPAHDANDLILARHYADHATTSRNPEHG
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|387891255|ref|NC_017911.1|:5808751-5809794 Pseudomonas fluorescens A506 chromosome, complete genome
ATGGAAAGCCAAGCCCGGACGGCGTCCGACCCTGTGAGAACCCTGGACGCGATGCACCAGGAGCCCTGGG
AATATGACTTCTTCCAGGCATTGCGGCGCATCGAGTGCGAAACGCCCGAGCTGCCACGCCTGGGCCATTC
CCTGCGCCTGGCCGATGATCCGCTGCGCCTGGGGCAGCAGGCCGATTGCACCTTCGCACCCGCCACCCTC
GCCTCGGTCGCCCCCGGTGGCGACGGCAAGCCGGCGCGGTTGGAGCAGTTCTTCTTCGGCCTTGGCGGCC
CCAACGGGCCGCTGCCGCTGCACATCACCGAGTACGTGCGCGAGCGCCAACGCAACAACGCCGACAGCAC
CAGCAAGCAGTTCCTGGATGTGTTCCACCATCGCTTGTTGACCCTGTTCTATCGGGCCTGGGCCGAGGCG
CGGCCAACGGTCAGCCATGACCGCCCGGACGATGACTACTGGTCCGCCCGCCTCGCCGCCCTGAGTGGCC
GCGGGATGCCGAGCCTGCTCAATCAAGGGCTGATCCCCGATACCGCGAAGCTGCATTACAGCGGCCATCT
GTCGGCGCAAACCCGTTACCCGGATGGCTTGAAAGCGATCCTGGGCGAGTACTTCGGCCTGCCGGTAGAG
ATCGAGGAATACGTCGGCCAATGGCTTGAACTGCCCGAACGCAGCCGCGTGGGGGTCAGCGCCAACCAGT
TGGGCGTGGACTTCTGCCTGGGCAGCCACGTATGGGACCGCCAGCACAAATTCCGCATCCGCCTGGGCCC
GCTCACGCTGGATAACTACATGGGCATGCTGCCCGGCCAACAGCCGTTCAACGAGCTGGTGGCGTGGGTG
GCCGAGTACCTGGGCCATGAATTGGACTGGGACTTGAACCTGGTTTTGCAACAACCCGAAGTACCGGCGC
TGCAACTCAACGGCCAGTTCCGCCTGGGCTTCAACACCTGGCTCGGCCAACCTGCGCATGACGCCAACGA
CCTAATCCTGGCCCGGCATTACGCCGACCACGCCACCACCTCAAGGAATCCAGAGCATGGGTGA