SecReT6
Protein ID: 387896396
SecReT6 ID657
T6SS typei3
Gene symbolclpV1
Locus tagPflA506_5307
StrainPseudomonas fluorescens A506
Repliconchromosome [GenBank: NC_017911] [Browse all T6SS(s) in this replicon]
Location [Strand]5809787..5812447 [+]
Producttype VI secretion ATPase ClpV1
NoteTssH
UniProt IDI2BNF4
KEGG IDpfc:PflA506_5307
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.00E-39, Aligned region: 615..781
AAA [PF00004], Evalue: 1.40E-18, Aligned region: 233..367
AAA [PF00004], Evalue: 1.40E-18, Aligned region: 621..705
ClpB_D2-small [PF10431], Evalue: 2.70E-15, Aligned region: 788..862
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 43..78
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 210..250
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 277..312
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 514..533
AAA_16 [PF13191], Evalue: 1.60E-12, Aligned region: 590..665
AAA_5 [PF07728], Evalue: 2.50E-12, Aligned region: 233..252
AAA_5 [PF07728], Evalue: 2.50E-12, Aligned region: 350..363
AAA_5 [PF07728], Evalue: 2.50E-12, Aligned region: 620..734
Sigma54_activat [PF00158], Evalue: 8.30E-07, Aligned region: 212..246
Sigma54_activat [PF00158], Evalue: 8.30E-07, Aligned region: 619..738
AAA_22 [PF13401], Evalue: 1.50E-06, Aligned region: 63..98
AAA_22 [PF13401], Evalue: 1.50E-06, Aligned region: 232..314
AAA_22 [PF13401], Evalue: 1.50E-06, Aligned region: 357..398
AAA_22 [PF13401], Evalue: 1.50E-06, Aligned region: 618..641
AAA_22 [PF13401], Evalue: 1.50E-06, Aligned region: 682..702
AAA_25 [PF13481], Evalue: 7.50E-06, Aligned region: 228..310
AAA_25 [PF13481], Evalue: 7.50E-06, Aligned region: 618..645
Clp_N [PF02861], Evalue: 2.70E-05, Aligned region: 29..75
Clp_N [PF02861], Evalue: 2.70E-05, Aligned region: 108..149
Zeta_toxin [PF06414], Evalue: 3.80E-05, Aligned region: 233..249
Zeta_toxin [PF06414], Evalue: 3.80E-05, Aligned region: 614..660
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 211..249
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 284..317
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 620..641
Arch_ATPase [PF01637], Evalue: 0.00014, Aligned region: 687..702
NACHT [PF05729], Evalue: 0.00028, Aligned region: 233..333
NACHT [PF05729], Evalue: 0.00028, Aligned region: 621..647
AAA_19 [PF13245], Evalue: 0.00031, Aligned region: 17..46
AAA_19 [PF13245], Evalue: 0.00031, Aligned region: 233..254
AAA_19 [PF13245], Evalue: 0.00031, Aligned region: 618..642
IstB_IS21 [PF01695], Evalue: 0.00041, Aligned region: 216..254
IstB_IS21 [PF01695], Evalue: 0.00041, Aligned region: 620..648
AAA_18 [PF13238], Evalue: 0.00045, Aligned region: 233..250
AAA_18 [PF13238], Evalue: 0.00045, Aligned region: 622..648
AAA_18 [PF13238], Evalue: 0.00045, Aligned region: 809..834
AAA_17 [PF13207], Evalue: 0.0013, Aligned region: 233..250
AAA_17 [PF13207], Evalue: 0.0013, Aligned region: 620..656
AAA_29 [PF13555], Evalue: 0.0017, Aligned region: 225..249
AAA_29 [PF13555], Evalue: 0.0017, Aligned region: 618..645
Torsin [PF06309], Evalue: 0.0021, Aligned region: 578..644
Protein Sequence: 886 a.a.     [Download]
>gi|387896396|ref|YP_006326693.1| type VI secretion ATPase ClpV1 [Pseudomonas fluorescens A506]
MGEISRAALFGKLNSVAYKAIEAATVFCKLRGNPYVELAHWFHQLLQLQDSDLHRIIRQFNVEPARLARD
LTEALDRLPRGSTSITDLSSHVEEAVERGWVYGSLMFGESQVRTGYLVLGILKTPSLRHALLGLSGEFDK
IKAEALSERFDEYVGDSPENALSASDGFNAGVPGEASGAMAPSAMGKQEALKRFTVDLTEQARSGKLDPI
VGRDEEIRQLVDILMRRRQNNPILTGEAGVGKTAVVEGFALRIVAGDVPPALKDVELRSLDVGLLQAGAS
MKGEFEQRLRQVIEDVQASPKPIILFIDEAHTLVGAGGAAGTGDAANLLKPALARGTLRTVAATTWAEYK
KHIEKDPALTRRFQVVQVAEPSEDKALLMMRGVASTMEKHHQVQILDEALEASVKLSHRYIPARQLPDKS
VSLLDTACARVAISLHAVPAEVDDSRRRIEALETELQIIAREHAIGIAIGARQTNSEALLTAERERLATL
ESRWAEEKALVDELLATRATLREKAGVVDSGNDELRAQLVDLQQRLTALQGETPLILPTVDYQAVASVVA
DWTGIPVGRMARNELETVLNLDQHLKKRIIGQDHALQMIAKRIQTSRAGLDNPSKPIGVFMLAGTSGVGK
TETALALAEAMYGGEQNVITINMSEFQEAHTVSTLKGAPPGYIGYGEGGVLTEAVRRKPYSVVLLDEVEK
AHPDVHEIFFQVFDKGVMEDGEGRVIDFKNTLILLTTNAGTELISQVCKDPANIPEPEEIAKALRQPLLE
IFPPALLGRLVTIPYYPLSDEMLKAITRLQLNRIKKRVENTHKVAFEYDDAVVVLIVSRCTETESGGRMI
DTILTNSLLPDMSREFLTRMLEGKALAGVRISSRDNELHYDFSDTE
 
Nucleotide Sequence: 2661 bp     [Download]
>gi|387891255|ref|NC_017911.1|:5809787-5812447 Pseudomonas fluorescens A506 chromosome, complete genome
ATGGGTGAAATCAGTCGCGCCGCACTGTTCGGCAAACTCAACAGCGTGGCCTACAAAGCCATCGAAGCCG
CCACCGTGTTCTGCAAATTACGGGGCAATCCGTATGTGGAACTGGCCCACTGGTTTCACCAGTTGTTGCA
ACTGCAGGACTCCGACCTGCACCGCATCATCCGCCAGTTCAACGTGGAGCCGGCGCGCCTGGCCCGCGAC
CTCACCGAAGCCCTGGACCGCCTGCCGCGCGGCTCCACGTCGATCACCGACCTGTCCTCCCATGTGGAAG
AGGCCGTAGAACGCGGCTGGGTGTATGGCAGCCTGATGTTTGGCGAAAGCCAGGTGCGCACCGGTTATCT
GGTGCTGGGCATCTTGAAGACACCGAGCCTGCGCCATGCGCTGCTGGGCCTGTCCGGCGAGTTCGACAAG
ATCAAGGCCGAGGCCTTGAGCGAGCGCTTTGACGAATACGTCGGTGACTCGCCGGAAAATGCCTTGAGCG
CCAGCGACGGTTTCAATGCCGGTGTGCCAGGCGAGGCCAGCGGTGCCATGGCGCCCAGCGCGATGGGCAA
GCAGGAAGCGCTCAAGCGTTTCACTGTGGACCTGACCGAACAGGCCCGCAGCGGCAAGCTCGACCCAATC
GTGGGCCGTGACGAGGAGATCCGACAACTGGTGGACATCCTCATGCGTCGGCGCCAGAACAACCCGATCC
TTACCGGTGAAGCCGGGGTGGGCAAGACCGCCGTGGTCGAAGGTTTCGCCCTGCGCATCGTCGCCGGTGA
CGTGCCGCCCGCCTTGAAAGACGTGGAGCTGCGCAGCCTCGACGTGGGCTTGCTGCAAGCCGGCGCCAGC
ATGAAAGGCGAGTTCGAACAGCGCCTGCGCCAGGTCATCGAAGACGTGCAGGCCTCGCCCAAGCCGATCA
TCCTGTTTATCGACGAAGCCCATACCCTGGTGGGTGCCGGTGGCGCTGCCGGCACCGGTGACGCAGCCAA
CCTGCTCAAGCCTGCCCTGGCCCGTGGCACCTTGCGTACCGTGGCTGCCACCACCTGGGCCGAGTACAAA
AAGCACATCGAGAAAGACCCGGCCCTGACCCGCCGCTTCCAAGTGGTGCAGGTTGCCGAACCGTCGGAAG
ACAAGGCCCTGCTGATGATGCGCGGCGTGGCTTCCACCATGGAAAAACACCATCAGGTGCAGATCCTCGA
CGAAGCTCTTGAAGCCTCGGTGAAGCTCTCCCACCGCTATATTCCGGCGCGCCAGTTGCCGGACAAGTCC
GTAAGCCTGCTGGACACCGCCTGCGCCCGCGTCGCTATCAGCTTGCACGCGGTACCAGCAGAAGTGGACG
ACAGCCGTCGGCGTATCGAGGCCCTGGAAACCGAGTTGCAAATCATCGCCCGTGAGCATGCGATCGGCAT
TGCCATTGGTGCGCGTCAAACCAATAGCGAAGCGCTGCTGACCGCCGAGCGTGAGCGTCTGGCCACGCTG
GAAAGCCGCTGGGCTGAAGAGAAAGCCTTGGTGGATGAACTGCTCGCCACCCGCGCAACCTTGCGCGAGA
AAGCCGGTGTGGTGGACAGCGGCAACGATGAGTTGCGTGCGCAATTGGTCGACCTGCAACAGCGCCTCAC
CGCCCTGCAAGGCGAAACCCCGTTGATCCTGCCGACCGTGGATTACCAGGCCGTGGCCTCGGTGGTCGCC
GACTGGACCGGCATCCCGGTGGGCCGCATGGCGCGCAATGAGCTGGAAACTGTGCTCAACCTCGACCAGC
ACCTGAAGAAACGCATCATCGGCCAGGACCATGCCCTGCAGATGATCGCCAAGCGCATCCAGACCTCCCG
CGCCGGCCTCGACAACCCGAGCAAGCCGATTGGCGTGTTCATGCTGGCCGGCACCTCGGGTGTGGGCAAG
ACCGAAACCGCCCTGGCCCTGGCCGAAGCCATGTATGGCGGTGAGCAGAACGTCATCACCATCAACATGA
GCGAGTTCCAGGAAGCCCACACCGTGTCCACCCTCAAGGGCGCGCCACCGGGCTATATCGGCTACGGCGA
AGGCGGTGTGCTGACCGAAGCGGTACGGCGCAAACCCTACAGCGTGGTGCTGCTCGATGAGGTGGAGAAA
GCTCACCCGGACGTGCATGAGATCTTCTTCCAGGTGTTCGACAAGGGCGTGATGGAGGACGGCGAGGGCC
GGGTGATCGACTTCAAGAACACCTTGATCCTGCTGACCACCAATGCCGGGACAGAGCTGATATCCCAGGT
GTGCAAAGACCCGGCGAACATCCCCGAGCCCGAGGAAATCGCCAAGGCCCTGCGCCAGCCACTGCTGGAG
ATTTTCCCGCCGGCCTTGCTCGGTCGCCTGGTGACCATCCCTTACTACCCGCTGAGCGACGAGATGCTCA
AAGCGATCACGCGCCTGCAACTGAACCGAATCAAGAAGCGCGTGGAGAACACCCATAAAGTCGCGTTCGA
GTATGACGACGCAGTGGTCGTCCTGATCGTCTCGCGCTGCACCGAGACCGAAAGCGGCGGGCGCATGATC
GACACCATCCTGACCAACAGCCTGCTGCCGGACATGAGCCGCGAGTTCCTCACGCGCATGTTGGAAGGCA
AGGCACTGGCGGGGGTGCGGATCAGTAGTCGGGATAATGAACTGCACTACGACTTCAGCGACACCGAATA
A