SecReT6
Protein ID: 387901143
SecReT6 ID658
T6SS typei4b
Gene symbol-
Locus tagMYA_0383
StrainBurkholderia sp. KJ006
Repliconchromosome I [GenBank: NC_017920] [Browse all T6SS(s) in this replicon]
Location [Strand]405723..408902 [+]
ProductVgrG protein
NoteTssI
UniProt IDI2DJC5
KEGG IDbuk:MYA_0383
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.50E-73, Aligned region: 41..353
Phage_GPD [PF05954], Evalue: 6.50E-73, Aligned region: 583..655
Phage_GPD [PF05954], Evalue: 6.50E-73, Aligned region: 825..927
DUF2345 [PF10106], Evalue: 2.90E-59, Aligned region: 668..820
DUF2345 [PF10106], Evalue: 2.90E-59, Aligned region: 933..1009
T6SS_Vgr [PF13296], Evalue: 7.80E-37, Aligned region: 524..630
T6SS_Vgr [PF13296], Evalue: 7.80E-37, Aligned region: 951..998
Phage_base_V [PF04717], Evalue: 5.50E-21, Aligned region: 424..514
Phage_base_V [PF04717], Evalue: 5.50E-21, Aligned region: 875..892
Sarcoglycan_1 [PF04790], Evalue: 0.0028, Aligned region: 713..785
Protein Sequence: 1059 a.a.     [Download]
>gi|387901143|ref|YP_006331482.1| VgrG protein [Burkholderia sp. KJ006]
MNMQNTVAALRGGLLQQDRLLKLDTPLGANVLTVQRAVGRARIGRAYEFTLDVLSTDSDVELKKLIAQPV
TLWIQQADRSYRPVNGYVHTARRLGADGGLTTYQLTFADFTHFLKFRRDQRIWNDTTVDQIISDVLNQHP
QARGHFRFALSQPLPSRSYTRQHDTDWHFVHRLMESEGLYTTWQQADDGKSHTLVITDNLQAFAPLSPQT
VRFYRGGTASDADAFTQWSGTRTLQSVTRTTRTFDYKNPSQPSNPKGTTLPTMADQGELPDQLEVYEYTG
AYTYLDQTRGDHLTKIRMEEWESQAKRFHGAGGVRAIDAGRRFTLSDHPEHDRDPAEQREFATIGVDWWI
ENNLPVASSSADFPYSLREALTQAQEGYGADPAFRVPHDDGSVGFYLVEVEAQRVSVPYRSPFEHEKPKM
HLETAIVVGPQGEEVYTDELNRIRVQFVWDRLNPGNENASCWVRVVQSDTGGGYGGVHVPRIGEEVLIDY
VGGDCDRPLAVGRVYNGANQPQWHSDGILSGYRSKEYSGSGYNQLVMDDATGQNRVQLMSSSANSLLHLG
YIIDQNGNTRGSYLGSGFDLRSDAYGAVRASRGLYVTTHPKAANSQPLDVTEAQQQLVSGESLIEALSGV
SEQHQAESLKDAQEAMRAFTDATQDRASGNASGGRTAGGGTGSANAFKEPVMLFGSPSGIAMSTQESLHM
VANDHVNVASGQSVHVAAGKSLIGSIGQKLSLFVQNAGMKLFAGKGKVEIQAQSDNVEVTAQKAVKVVSA
TDRIEIAADQGILLTSGGAYIRVKDGNVEIHAPGKIDVKGASHTFAGPASLGYPLPSARPDQPGQLELFH
KYMNGEAVKGGLFTVKDVNGTVLKKGALDNSGYTVVSGLPPGAVRVEFGKDPRASDQPANYFKQAKWPAE
PVAPSPEAAQAAASGQLASQLQGMAPAASTAAMGFASGSGAGAALGGLAGAALPAAAAAVGGAGVASAVQ
TASSLSGAAKQVAAMVQTARQGGLAALAAPAANAASGALQSALPGVAGVAGKAATTTATASAAGGMKLPT
SGFGGPLKS
 
Nucleotide Sequence: 3180 bp     [Download]
>gi|387900762|ref|NC_017920.1|:405723-408902 Burkholderia sp. KJ006 chromosome 1, complete sequence
ATGAACATGCAGAACACTGTTGCCGCATTGCGCGGCGGGTTGCTTCAGCAGGACCGGCTGTTGAAGCTCG
ATACGCCACTGGGTGCCAACGTGCTGACCGTGCAACGAGCGGTCGGCCGTGCGCGCATCGGCCGGGCCTA
TGAATTCACGCTCGACGTGCTGTCGACCGACAGCGACGTGGAGCTGAAAAAGCTGATCGCGCAACCGGTC
ACGCTATGGATTCAGCAAGCCGACCGCAGCTACCGGCCCGTCAACGGCTACGTGCACACGGCGCGGCGCC
TGGGCGCCGACGGCGGGCTCACCACCTACCAGCTGACGTTCGCCGATTTCACCCATTTCCTGAAGTTCCG
TCGCGATCAGCGCATCTGGAACGACACGACCGTCGACCAGATCATCAGCGATGTGCTGAACCAGCATCCG
CAGGCGCGCGGGCATTTCCGCTTCGCGCTGTCGCAGCCGCTGCCAAGCCGCTCGTACACGCGCCAGCACG
ACACCGACTGGCATTTCGTGCATCGGCTGATGGAGAGCGAAGGCCTTTACACCACATGGCAGCAGGCCGA
CGACGGCAAGTCGCACACGCTCGTCATCACCGACAACCTGCAGGCGTTTGCGCCGCTGTCGCCGCAAACC
GTGCGTTTCTATCGCGGCGGGACGGCGAGCGATGCCGACGCGTTCACGCAGTGGTCGGGCACGCGCACGC
TGCAGAGCGTCACGCGCACGACACGCACGTTCGACTACAAGAACCCTTCCCAGCCGTCGAATCCGAAGGG
CACGACGCTGCCGACGATGGCCGATCAGGGCGAATTGCCCGACCAGCTCGAAGTCTACGAGTACACCGGT
GCGTACACGTACCTCGACCAGACCCGCGGCGACCATCTGACGAAGATCCGGATGGAGGAATGGGAGTCGC
AGGCGAAGCGCTTCCACGGCGCGGGCGGCGTGCGTGCGATCGATGCGGGCCGGCGCTTCACGCTGTCGGA
TCATCCCGAACACGATCGCGATCCGGCCGAGCAGCGCGAGTTCGCGACGATCGGCGTCGACTGGTGGATC
GAGAACAACCTGCCGGTCGCGAGCAGCAGCGCGGACTTTCCGTACAGTCTGCGCGAAGCGTTGACGCAAG
CTCAGGAAGGCTACGGGGCCGATCCGGCATTTCGCGTGCCGCACGACGACGGCTCGGTGGGCTTCTATCT
CGTCGAAGTCGAAGCGCAGCGGGTGAGCGTGCCGTATCGCAGCCCGTTCGAGCACGAGAAGCCGAAGATG
CATCTGGAGACGGCGATCGTCGTCGGCCCGCAGGGCGAGGAAGTCTATACGGACGAGTTGAACCGGATCC
GCGTGCAGTTCGTGTGGGATCGCCTCAATCCGGGCAACGAGAACGCGTCGTGCTGGGTGCGCGTCGTGCA
GTCGGACACGGGTGGCGGCTACGGCGGCGTGCACGTGCCGCGCATCGGCGAGGAAGTGCTGATCGACTAC
GTCGGCGGCGACTGCGACCGGCCGCTGGCGGTCGGGCGCGTGTACAACGGCGCGAACCAGCCGCAGTGGC
ATAGCGACGGCATTCTCTCCGGATACCGCTCGAAGGAATATTCGGGCAGCGGCTACAACCAGCTCGTGAT
GGACGACGCGACCGGGCAGAACCGCGTGCAGCTGATGAGCAGCAGCGCGAACAGCCTGCTGCATCTCGGC
TACATCATCGACCAGAACGGCAACACGCGCGGGTCGTATCTGGGCAGCGGCTTCGATCTGCGCTCGGACG
CATACGGCGCGGTGCGGGCGAGCCGCGGCCTGTACGTGACGACCCATCCGAAGGCAGCGAACAGCCAGCC
GCTCGACGTGACGGAAGCGCAGCAGCAGCTCGTGTCCGGGGAGAGCCTGATCGAGGCGCTGTCGGGCGTG
AGCGAGCAGCATCAGGCCGAAAGCCTGAAAGACGCGCAGGAGGCGATGCGTGCGTTCACCGACGCGACGC
AGGACCGTGCATCGGGCAACGCATCGGGCGGCCGCACGGCGGGCGGCGGCACGGGGAGCGCGAACGCGTT
CAAGGAGCCGGTGATGCTGTTCGGCAGCCCGTCGGGGATCGCGATGTCGACGCAGGAGTCGCTGCACATG
GTCGCGAACGATCACGTGAACGTCGCGAGCGGCCAGAGCGTGCATGTCGCGGCGGGCAAATCGCTGATCG
GCAGCATCGGCCAGAAGCTGAGCCTGTTCGTGCAGAACGCGGGGATGAAGCTGTTCGCGGGCAAGGGCAA
GGTGGAGATCCAGGCGCAGTCGGACAACGTCGAGGTGACCGCGCAGAAGGCGGTGAAGGTTGTATCCGCA
ACCGACCGGATCGAGATCGCGGCCGATCAGGGGATTCTGCTGACGAGCGGCGGGGCGTACATCCGAGTCA
AGGATGGCAACGTCGAAATCCACGCACCGGGCAAGATCGATGTGAAGGGCGCGTCGCATACGTTCGCCGG
ACCGGCGAGCCTGGGCTATCCGTTGCCGAGCGCGCGGCCCGATCAGCCGGGCCAGCTGGAGCTGTTCCAC
AAGTACATGAACGGCGAGGCCGTGAAGGGCGGGCTCTTCACGGTGAAGGACGTGAATGGCACGGTGCTGA
AGAAGGGCGCGCTCGACAACAGCGGCTATACCGTCGTCAGCGGCTTGCCGCCGGGCGCGGTGCGCGTCGA
GTTCGGCAAGGATCCGCGCGCGTCGGACCAGCCGGCGAATTACTTCAAGCAGGCGAAGTGGCCGGCCGAG
CCGGTGGCGCCTTCGCCGGAAGCCGCGCAGGCGGCGGCGAGCGGACAGCTTGCGAGCCAGTTGCAAGGCA
TGGCGCCGGCGGCATCCACGGCGGCGATGGGGTTCGCGAGCGGCAGCGGCGCCGGCGCCGCACTTGGCGG
GCTCGCGGGCGCCGCGTTGCCGGCCGCGGCGGCTGCGGTCGGCGGAGCGGGCGTCGCGTCGGCCGTGCAG
ACGGCCTCCAGCCTTAGTGGCGCGGCAAAGCAGGTGGCTGCAATGGTGCAGACCGCGCGCCAGGGCGGCC
TGGCTGCGCTCGCCGCGCCTGCCGCAAATGCTGCGTCGGGCGCGCTCCAGAGCGCGTTGCCCGGTGTCGC
CGGAGTCGCGGGCAAGGCCGCAACGACGACTGCGACGGCGTCGGCAGCGGGCGGCATGAAGCTGCCGACG
AGCGGCTTCGGCGGACCGTTGAAATCCTGA