SecReT6
Protein ID: 387901147
SecReT6 ID658
T6SS typei4b
Gene symbol-
Locus tagMYA_0387
StrainBurkholderia sp. KJ006
Repliconchromosome I [GenBank: NC_017920] [Browse all T6SS(s) in this replicon]
Location [Strand]415905..416687 [-]
Producttransmembrane protein
NoteTssL
UniProt IDI2DJC9
KEGG IDbuk:MYA_0387
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.90E-58, Aligned region: 30..231
Protein Sequence: 260 a.a.     [Download]
>gi|387901147|ref|YP_006331486.1| transmembrane protein [Burkholderia sp. KJ006]
MSYAPSLFGDNAPAPLHTPASTDAAFQARSLLDLLYDGFFMLFLLKNGRAPDSASEFSTKIQEFLSDFER
GAKKLNIAAEDVYAAKFAYCAAVDEMVLSSQFKIRADWERRPLQLVLFGEQLAGEKFFQYLEECRAQGAA
RLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIAHMKGKRAAFAPHWPLPDQIAHRLKREVPVW
AIGAVFALVALLGYLGLNTYLKDKTLQALAPYSQVIKVGPESANLTISLP
 
Nucleotide Sequence: 783 bp     [Download]
>gi|387900762|ref|NC_017920.1|:c416687-415905 Burkholderia sp. KJ006 chromosome 1, complete sequence
ATGAGCTACGCGCCTTCCCTGTTCGGCGACAACGCGCCGGCCCCGTTGCATACCCCGGCGTCGACCGACG
CCGCGTTCCAGGCCCGCTCGCTGCTCGACCTGCTGTACGACGGGTTCTTCATGCTGTTCCTGCTCAAGAA
CGGCCGCGCGCCGGACAGCGCGAGCGAGTTCAGCACGAAGATTCAGGAATTCCTGTCGGACTTCGAACGC
GGCGCGAAGAAGCTGAATATCGCGGCGGAGGACGTGTATGCGGCGAAGTTCGCGTATTGCGCGGCCGTCG
ACGAGATGGTGCTGTCGTCGCAGTTCAAGATCCGGGCCGACTGGGAACGCCGGCCGCTGCAGCTGGTGCT
GTTCGGCGAGCAGCTCGCGGGCGAGAAGTTCTTCCAGTATCTGGAGGAATGCCGGGCGCAAGGTGCGGCG
CGGCTGCAGTCGCTCGAGGTGTTCCACATGTGCCTGCTGCTCGGGTTCCAGGGCAAGTATCTGCTCGAGG
GGCCGGAGAAGCTCGCTTATCTCACCGCGCGGCTCGGCGACGAGATCGCGCATATGAAGGGCAAGCGCGC
TGCGTTCGCGCCGCATTGGCCGCTGCCGGATCAGATTGCACACCGGCTGAAGCGCGAGGTGCCGGTGTGG
GCGATCGGTGCGGTGTTCGCGCTTGTGGCGCTGCTCGGGTATCTCGGGCTCAACACCTATCTGAAGGACA
AGACGCTGCAGGCGCTCGCGCCTTATTCGCAGGTGATCAAGGTCGGGCCAGAGTCGGCGAATTTGACGAT
TTCGTTGCCTTGA