SecReT6
Protein ID: 387901148
SecReT6 ID658
T6SS typei4b
Gene symbol-
Locus tagMYA_0388
StrainBurkholderia sp. KJ006
Repliconchromosome I [GenBank: NC_017920] [Browse all T6SS(s) in this replicon]
Location [Strand]416684..418030 [-]
Producttype VI secretion protein, VC_A0114 family
NoteTssK
UniProt IDI2DJD0
KEGG IDbuk:MYA_0388
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.20E-136, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|387901148|ref|YP_006331487.1| type VI secretion protein, VC_A0114 family [Burkholderia sp. KJ006]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGLRSVRIDRDALGSNVLRVAELALVFP
DGALYAAPQADDLPPPIALDTLPDGINEFVFYLALHPLRENGTNYSDDPASGFTTRFVSEQTSVADNFTD
AAEADITFLKTQVKLIAHSEPRDQLLSVPLVRVRRTATSGFELDDSFVPPCLAIEASPILHQRLRQLVDA
LQAKVNALYGFHREPSKNIIEFRSGDIASFWLLHTANAAFATLAHLHQHAALHPERLFQELLRLAGQLMT
FSKGYTLADLPVYRHDDPGPSFARLDLMLRELLDTVISTRYFAITLDEVRPSFHLGRLDSGKIDDKTEFY
LAVSADMPNVELIDAVPARFKVGAPDDVDKLVLSAMPGVRLSYMPQVPPAIPVRPGACYFQLDSRGALYE
RMLQAQSAMIYAPTGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|387900762|ref|NC_017920.1|:c418030-416684 Burkholderia sp. KJ006 chromosome 1, complete sequence
ATGAGTTATTCGGCCAAGGTGCTGTGGGGGGAAGGGCTGTTCCTCCGGCCTCAACACTTTCAACGGCAGG
ACGCCTATCACGAGGCGCGCCTGTTCGAATCGATCCAGGCGATCCAGCCGTACAACTGGGGCTTGCGCTC
GGTGCGCATCGATCGCGATGCGCTCGGCAGCAACGTGCTGCGCGTGGCCGAGCTCGCGCTCGTGTTCCCG
GACGGCGCGCTGTATGCCGCGCCGCAGGCCGACGACCTGCCGCCGCCGATCGCGCTCGACACGCTGCCCG
ACGGCATCAACGAATTCGTGTTCTACCTCGCGCTGCATCCGCTGCGCGAGAACGGCACCAACTACAGCGA
CGATCCGGCGTCCGGCTTCACGACGCGTTTCGTCAGCGAGCAGACGAGCGTCGCCGACAACTTCACCGAC
GCGGCCGAAGCCGACATCACGTTCCTGAAGACGCAGGTGAAGCTGATCGCGCACAGCGAGCCGCGCGACC
AGTTGCTGTCGGTGCCGCTCGTGCGCGTGCGGCGCACGGCGACGTCCGGCTTCGAGCTCGACGACAGCTT
CGTGCCGCCGTGTCTCGCGATCGAAGCGTCGCCGATCCTGCACCAGCGGCTGCGCCAGCTGGTCGACGCG
CTGCAGGCGAAGGTCAATGCGCTGTACGGCTTTCACCGCGAGCCGTCGAAGAACATCATCGAGTTCCGTT
CGGGCGACATCGCGTCGTTCTGGCTGCTGCACACCGCGAACGCTGCGTTCGCGACGCTCGCGCATCTGCA
TCAGCATGCGGCACTGCATCCGGAGCGGCTGTTCCAGGAGCTGCTGCGCCTCGCGGGCCAGCTGATGACG
TTCTCGAAGGGCTACACGCTCGCCGACCTGCCCGTGTATCGCCACGACGATCCGGGCCCGAGCTTCGCTC
GTCTCGACCTGATGCTGCGCGAGCTGCTCGACACCGTGATCTCGACGCGCTACTTCGCGATCACGCTCGA
CGAAGTGCGTCCGTCGTTCCACCTCGGCCGCCTCGATTCGGGCAAGATCGACGACAAGACCGAGTTCTAT
CTGGCCGTGTCCGCCGACATGCCGAACGTCGAACTCATCGACGCGGTGCCGGCCCGCTTCAAGGTCGGTG
CGCCGGACGACGTCGACAAGCTCGTGCTGTCGGCGATGCCCGGCGTGCGGCTGTCGTACATGCCGCAGGT
GCCGCCCGCGATTCCGGTGCGGCCCGGTGCGTGTTACTTCCAGCTCGACTCGCGCGGCGCGCTGTACGAG
CGCATGCTGCAGGCCCAGTCGGCGATGATCTATGCGCCGACTGGCATCAATGACCTGAAATTCGAACTGA
TCGCGGTCACATCATGA