SecReT6
Protein ID: 387901149
SecReT6 ID658
T6SS typei4b
Gene symbol-
Locus tagMYA_0389
StrainBurkholderia sp. KJ006
Repliconchromosome I [GenBank: NC_017920] [Browse all T6SS(s) in this replicon]
Location [Strand]418133..418744 [-]
Producttype VI secretion lipoprotein/VasD
NoteTssJ
UniProt IDI2DJD1
KEGG IDbuk:MYA_0389
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-36, Aligned region: 16..175
LPAM_1 [PF08139], Evalue: 0.0063, Aligned region: 6..23
Protein Sequence: 203 a.a.     [Download]
>gi|387901149|ref|YP_006331488.1| type VI secretion lipoprotein/VasD [Burkholderia sp. KJ006]
MKSTMIRYALPLLASALLAGCAAAPLLGSAASAVMQAAGIGKPELPDSQKPPRNIGLTLAAASNLNAAND
RKPLALVVRLYSLKDPTSFQQAPFDAFTDPTKEKAALGADLLNVREITLIPGQRYTATEKVSREAQAFGI
VALFRDPAIQRWKLTFDPAKSEKSGIIIGLHNCAMTVTDGTVIAPQQGAPSQPLNLLSSVTCG
 
Nucleotide Sequence: 612 bp     [Download]
>gi|387900762|ref|NC_017920.1|:c418744-418133 Burkholderia sp. KJ006 chromosome 1, complete sequence
ATGAAATCGACCATGATTCGCTATGCGCTGCCGCTGCTCGCGAGCGCGCTGCTGGCCGGATGTGCGGCCG
CCCCGTTGCTCGGCTCGGCCGCGAGCGCCGTGATGCAGGCCGCCGGCATTGGCAAGCCCGAGCTCCCGGA
TTCGCAGAAGCCGCCGCGCAACATCGGGCTTACGCTCGCGGCGGCGTCGAACCTGAACGCCGCGAACGAT
CGCAAGCCGCTCGCATTGGTGGTGAGACTCTACTCGCTGAAGGACCCGACTTCGTTCCAGCAGGCGCCGT
TCGACGCGTTCACCGATCCGACCAAGGAAAAGGCCGCGCTCGGCGCCGATCTGCTGAACGTGCGCGAGAT
CACGCTGATTCCGGGCCAGCGCTATACGGCGACCGAAAAGGTGTCGCGCGAAGCGCAGGCATTCGGCATC
GTCGCACTGTTCCGCGATCCGGCCATCCAGCGCTGGAAACTGACGTTCGACCCGGCAAAGTCGGAGAAAT
CCGGCATAATCATCGGCCTGCATAATTGCGCGATGACGGTCACCGATGGCACCGTGATCGCACCGCAACA
GGGTGCGCCTTCGCAACCGCTGAATTTGCTTTCGTCGGTCACCTGCGGATAA