SecReT6
Protein ID: 387901151
SecReT6 ID658
T6SS typei4b
Gene symbol-
Locus tagMYA_0391
StrainBurkholderia sp. KJ006
Repliconchromosome I [GenBank: NC_017920] [Browse all T6SS(s) in this replicon]
Location [Strand]419809..420324 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDI2DJD3
KEGG IDbuk:MYA_0391
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.10E-59, Aligned region: 11..163
Protein Sequence: 171 a.a.     [Download]
>gi|387901151|ref|YP_006331490.1| type VI secretion protein [Burkholderia sp. KJ006] [TssB]
MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVGDLAGQSEVEQPKLRDRKFVNIDRDNF
DDVMKAIEPRAAFQVENRLSADGGKFAVDLKFRSLSDFSPDEVVEQVEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLTNTQQLQELAKGTGGDKDGE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|387900762|ref|NC_017920.1|:419809-420324 Burkholderia sp. KJ006 chromosome 1, complete sequence [TssB]
ATGGCCAAGAAAGAGAGCATTCAGAAAAGTCTGCAGAAGATACGGCCGCCGCGTGTCCAGCTGACCTACG
AGGTCGAGAAGGGCGACGCGATCGAGGTGAAGGAACTGCCGTTCGTCGTCGGGGTCGTCGGCGATCTGGC
GGGCCAGTCGGAAGTCGAGCAGCCGAAGCTGCGCGACCGCAAGTTCGTCAACATCGACCGCGACAACTTC
GACGACGTGATGAAGGCGATCGAGCCGCGCGCCGCGTTTCAGGTGGAGAACCGCCTGAGCGCGGACGGCG
GCAAGTTCGCGGTCGACCTGAAGTTCCGCTCGCTGTCGGATTTCAGCCCGGACGAAGTCGTCGAGCAGGT
CGAGCCGCTGCGCCGCCTGCTCGAGGCGCGCTCCAAGCTCGCCGATCTGCGCAACAAGCTTGCCGGCAAC
GACAAGCTCGAGGATCTGCTGTCCGAGGTGCTGACGAACACGCAGCAGCTGCAGGAGCTCGCGAAGGGCA
CCGGCGGCGACAAAGACGGCGAATGA