SecReT6
Protein ID: 387901152
SecReT6 ID658
T6SS typei4b
Gene symbol-
Locus tagMYA_0392
StrainBurkholderia sp. KJ006
Repliconchromosome I [GenBank: NC_017920] [Browse all T6SS(s) in this replicon]
Location [Strand]420340..421830 [+]
Producttype VI secretion protein, EvpB/VC_A0108 family
NoteTssC
UniProt IDI2DJD4
KEGG IDbuk:MYA_0392
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.70E-191, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|387901152|ref|YP_006331491.1| type VI secretion protein, EvpB/VC_A0108 family [Burkholderia sp. KJ006]
MNQQTAAAQASGAEYAAGTSLLDDIVEKSKVAKSDSEHARAKDLIGELVHQVLDGTVIVSDNLSATIDAR
VAELDRLISTQLSAVMHAPEFQRLESTWRGLDYLVKESNTGQTIKIKALHAPKRDLVRDFKGASEFDQSA
LFKKVYEEEFGTFGGSPFGALIGDYEISRQPEDMYFIEQMSHVAAAAHAPFIASASPELLGLESFADLGK
PRDLGKVFDTVEYAKWKSFRDAEDSRYVGLTLPRFLGRLPFNPKDGQTAENFNFVEDVDGTEHDKYLWCN
AAWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDNASQEQKAQFPLREASIQVSEIPGKPGSYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|387900762|ref|NC_017920.1|:420340-421830 Burkholderia sp. KJ006 chromosome 1, complete sequence
ATGAACCAGCAAACGGCTGCGGCCCAAGCGAGCGGCGCGGAATATGCCGCCGGGACTTCGCTGCTCGACG
ACATCGTCGAGAAGAGCAAGGTCGCGAAATCCGATTCCGAGCATGCGCGTGCGAAGGACCTGATCGGCGA
GCTCGTGCATCAGGTGCTCGACGGCACGGTGATCGTGTCCGACAACCTGTCGGCGACGATCGACGCGCGG
GTCGCCGAGCTCGACCGCCTGATCTCCACGCAGCTGTCCGCGGTGATGCATGCGCCGGAGTTCCAGCGCC
TCGAAAGCACGTGGCGCGGCCTCGACTATCTGGTCAAGGAAAGCAACACCGGCCAGACGATCAAGATCAA
GGCGCTGCACGCGCCGAAGCGCGACCTCGTGCGCGACTTCAAGGGCGCGAGCGAGTTCGACCAGAGCGCG
CTGTTCAAGAAGGTCTACGAAGAAGAGTTCGGCACGTTCGGCGGCTCGCCGTTCGGTGCGCTGATCGGCG
ATTACGAGATCTCGCGCCAGCCGGAAGACATGTACTTCATCGAGCAGATGTCGCACGTCGCGGCTGCCGC
GCACGCGCCGTTCATCGCATCGGCGTCGCCGGAGCTGCTCGGCCTCGAGTCGTTCGCCGATCTCGGCAAG
CCGCGCGACCTCGGCAAGGTGTTCGACACGGTCGAATACGCGAAGTGGAAGTCGTTCCGCGATGCCGAAG
ATTCGCGCTACGTCGGCCTCACGCTGCCGCGCTTCCTCGGTCGCCTGCCGTTCAATCCGAAGGACGGCCA
GACCGCGGAGAACTTCAACTTCGTCGAGGACGTCGACGGCACCGAGCACGACAAATACCTGTGGTGCAAC
GCGGCGTGGGCCTTCGCGGCGCGCCTGACGGCCGCGTTCGACGACTTCGGCTGGTGCGCGGCGATCCGCG
GCGTCGAAGGCGGCGGCCTCGTCGAGGACTTGCCGACCCACACGTTCAAGACCGACGACGGTGAAGTCGC
GTTGAAGTGCCCGACCGAAATCGCGATCACCGATCGCCGCGAGAAGGAGCTGAGCGACCTCGGCTTCATC
CCGCTCGTGCATTGCAAAAACTCGGATTACGCTGCGTTCTTCGCCGCGCAATCGGTGCAGAAGCCGAAAA
AATACAGCACCGACAGCGCGAATGCGAACGCCGTCCTGTCTGCCCAGCTTCAGTACATCTTCTCGGTATC
GCGCGTCGCGCACTACCTGAAGGCGATGATGCGGGACAAGATCGGCAGCTTCGCATCGGCGCAGAACGTG
GAGACTTTCCTCAACCGGTGGATTTCGCAATACGTTCTGCTCGACGACAACGCATCGCAGGAGCAGAAAG
CGCAATTTCCGCTGCGCGAGGCATCCATACAAGTATCGGAGATTCCGGGCAAGCCGGGCTCGTATCGTTC
GGTCGCGTTCCTGCGCCCGCACTTTCAGCTCGACGAACTCTCGATTTCTCTGCGACTTGTCGCTGATCTG
CCCAAACCGGCAAATTCATAA