SecReT6
Protein ID: 387901153
SecReT6 ID658
T6SS typei4b
Gene symbol-
Locus tagMYA_0393
StrainBurkholderia sp. KJ006
Repliconchromosome I [GenBank: NC_017920] [Browse all T6SS(s) in this replicon]
Location [Strand]421937..422404 [+]
Producthypothetical protein
NoteTssD
UniProt IDI2DJD5
KEGG IDbuk:MYA_0393
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.20E-42, Aligned region: 2..127
Protein Sequence: 155 a.a.     [Download]
>gi|387901153|ref|YP_006331492.1| hypothetical protein MYA_0393 [Burkholderia sp. KJ006]
MKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMIFTKEIDSSSPLLYQHASGGTTF
DEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVREEGLPIETFSLKYAAVQWKQTQQKIGGNQGGNT
QGAWSLTKNDKTYAV
 
Nucleotide Sequence: 468 bp     [Download]
>gi|387900762|ref|NC_017920.1|:421937-422404 Burkholderia sp. KJ006 chromosome 1, complete sequence
GTGAAGGGCGAGTCCGCCGACAAGGACCATCAGGGCTGGATCGAACTGAAATCGTGGGATCACTCGATCG
TTCAGCCGCGTTCGGCAACGGCATCGACCGCAGGCGGTCACACGATGACGCGTTGCGAGCACGGCGACAT
GATCTTCACGAAGGAGATCGATTCGTCGAGCCCGCTGCTGTATCAGCACGCTTCGGGCGGCACCACGTTC
GACGAAGTCACGGTCCATTTCTCGCGCGCGGACGGCGAAGGCAAGCGCGTGCAGTATCTGGAAGTGAAGC
TCAAGTACGTGATCATCTCGAGCATCGCGCCGAGCGTGCGTGAAGAAGGTCTGCCGATCGAGACGTTCTC
GCTCAAGTACGCAGCCGTGCAGTGGAAGCAAACCCAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACG
CAGGGCGCCTGGAGTCTGACGAAGAACGACAAGACCTACGCGGTCTAA